KEGG   Pseudomonas poae: H045_16470Help
Entry
H045_16470        CDS       T02456                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppz  Pseudomonas poae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3764083..3764643
Genome map
AA seq 186 aa AA seqDB search
MTVSLPHHYREILKGLGEDPEREGLLDTPKRAAKAMQYLCHGYEQNLETIVNGALFASDN
DEMVILKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLT
RQIADAIQDVTQAAGVAVVIEARHMCMMMRGVEKQNSTMNTSVMLGAFRESSTTRMEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgactgtatccctgccccaccactaccgcgagatccttaaaggcttgggtgaagacccg
gagcgcgaaggcctgctcgacacccccaagcgcgccgccaaggccatgcagtacctgtgt
catggctacgagcagaacctggaaaccatcgtcaacggcgcgctgtttgcgtccgacaac
gatgaaatggtgatcctcaaggacatcgagctgtattcgctgtgcgagcaccacctgctg
ccctttatcggcaaggcccatgtggcctatattccgaccggcaaggtgctgggcctgtcg
aagctggcgcgcatcgtggacatgttcgcccggcgcctgcagatccaggaaaacctcacg
cggcagatcgccgacgccattcaggacgtgacccaggccgccggcgtggcggtggtgatc
gaggcccggcacatgtgcatgatgatgcgcggcgtggaaaaacagaattcaaccatgaac
acttcggtgatgctcggcgcatttcgcgagtcgagcaccacgcgcatggagttcctgcaa
ctgattggacggagcaagtag

DBGET integrated database retrieval system