KEGG   Pseudomonas poae: H045_16470Help
Entry
H045_16470        CDS       T02456                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppz  Pseudomonas poae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H045_16470
Enzymes [BR:ppz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H045_16470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3764083..3764643
Genome map
AA seq 186 aa AA seqDB search
MTVSLPHHYREILKGLGEDPEREGLLDTPKRAAKAMQYLCHGYEQNLETIVNGALFASDN
DEMVILKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLT
RQIADAIQDVTQAAGVAVVIEARHMCMMMRGVEKQNSTMNTSVMLGAFRESSTTRMEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgactgtatccctgccccaccactaccgcgagatccttaaaggcttgggtgaagacccg
gagcgcgaaggcctgctcgacacccccaagcgcgccgccaaggccatgcagtacctgtgt
catggctacgagcagaacctggaaaccatcgtcaacggcgcgctgtttgcgtccgacaac
gatgaaatggtgatcctcaaggacatcgagctgtattcgctgtgcgagcaccacctgctg
ccctttatcggcaaggcccatgtggcctatattccgaccggcaaggtgctgggcctgtcg
aagctggcgcgcatcgtggacatgttcgcccggcgcctgcagatccaggaaaacctcacg
cggcagatcgccgacgccattcaggacgtgacccaggccgccggcgtggcggtggtgatc
gaggcccggcacatgtgcatgatgatgcgcggcgtggaaaaacagaattcaaccatgaac
acttcggtgatgctcggcgcatttcgcgagtcgagcaccacgcgcatggagttcctgcaa
ctgattggacggagcaagtag

DBGET integrated database retrieval system