KEGG   Pseudomonas poae: H045_16520Help
Entry
H045_16520        CDS       T02456                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppz  Pseudomonas poae
Pathway
ppz00330  Arginine and proline metabolism
ppz00332  Carbapenem biosynthesis
ppz01100  Metabolic pathways
ppz01130  Biosynthesis of antibiotics
ppz01230  Biosynthesis of amino acids
Module
ppz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    H045_16520
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    H045_16520
Enzymes [BR:ppz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     H045_16520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGE27367
Position
complement(3771337..3772455)
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAQRWVVKIGSALLTADGKGLDRAAMSVWVEQMVALHEAGVELVLVSSGAVAAG
MSRLGWTARPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLN
ARSTLRALVELKVIPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAQLIYEARADDPALDAVAGSVGGALGRGGMQTKLRAARLAARSGAHTIIVGG
RLERVLDRLKAGERIGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVSALSQGNKSL
LPVGVKRVQGSFRRGEMVVCVAPDGREIARGLANYSALEAQKIIGQSSDAIVGVLGYMAE
PELVHRDNLILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcaaagtgacaggcgcgcagcgctgggtcgtaaagatcggaagtgcgctgctg
acggcggatggcaaaggtctggatcgcgcagcaatgagcgtctgggtcgagcagatggtg
gccttgcatgaagcgggcgtggagttggtgctggtgtcctcgggcgccgttgctgccggc
atgagccgcctcggctggaccgcgcgacccagcgcgatgcatgaactgcaagccgccgcc
gccatcggccagatgggtctggtgcaggcctgggaatcgagctttgccgagcatggtcgc
catacggcgcagatcctgctgacccacgacgacctgtccgaccgcaagcgctacctcaac
gcccgcagcaccttgcgcgcactggtggagctcaaggtgatcccggtgatcaacgagaac
gacacggtggtcaccgatgaaatccgcttcggcgacaacgacaccctggccgcgctggtc
gccaatctggtcgaagccgacttgctggtgattctgactgatcgcgacggcatgttcgac
gccgacccgcgcaacaaccccgacgcgcagcttatttatgaggcgcgcgcggacgacccc
gcgctggacgcggtcgccggcagcgtcggcggcgccctgggtcgtggcggcatgcagacc
aagctgcgcgccgctcgcctggcggcgcgttccggtgctcacaccatcatcgttggcggg
cgccttgagcgcgtgctggatcgcctaaaggccggcgagcgcatcggcacgctgctgtcg
ccggagcgcggcatgctggcggcgcgcaagcagtggctggcggggcatttgcaaacccgt
ggcaccctggtgctggacgccggtgcggtctcggcgttatctcagggcaacaagagcctg
ttgccggtgggcgtcaaacgggtgcagggcagcttccgccgtggcgagatggtggtgtgt
gtagcgcctgatggtcgcgaaatcgcccggggcctggccaactacagtgccctggaagcg
cagaagattattggacaatcgtctgacgccattgtcggagtattgggttacatggccgag
ccggaactggttcaccgcgacaacctgatcctggtttaa

DBGET integrated database retrieval system