KEGG   Pseudomonas poae: H045_18165Help
Entry
H045_18165        CDS       T02456                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppz  Pseudomonas poae
Pathway
ppz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01130  Biosynthesis of antibiotics
ppz01230  Biosynthesis of amino acids
Module
ppz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H045_18165 (trpC)
Enzymes [BR:ppz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     H045_18165 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AGE27695
Position
complement(4150211..4151047)
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLQKILARKAEEVAERRARVSLAELEAQAKVADAPRGFANALIAQAKLKQPAVIA
EVKKASPSKGVIREHFVPSEIAASYEKGGATCLSVLTDIDYFQGSDLFLQQARAACKLPV
IRKDFMVDPYQIIEARALGADCVLLIVSALDDVKLAELAAVAKSVGLDVLVEVHDGDELE
RALNTVDTRLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLVITESGIANRADVELMEING
VYSFLVGETFMRAEHPGAELQRLFFPERGVPVGGSTLD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccaaccgttctacaaaagattttggcccgcaaggcagaagaagtcgccgag
cgccgcgcgcgcgtgagcctggccgagctggaagcgcaggcgaaagttgccgatgccccg
cgcggttttgccaatgccttgatcgcccaggcaaagctcaagcagcctgcggtgatcgcc
gaggtgaaaaaggcctcgccgagcaaaggcgtaattcgtgaacacttcgttccctccgaa
attgccgccagttacgagaagggcggggcgacctgcctctcggtgctgaccgacatcgac
tacttccagggctccgacctgttcctgcagcaggcgcgggcggcgtgcaagctgccggtg
atccgcaaggatttcatggttgacccgtatcagatcatcgaagcccgtgccctgggcgcc
gactgcgtactgctgatcgtctccgcgctggatgacgtgaagctggccgagctggcggcg
gtggccaagagcgtcggtctcgacgtgttggttgaagtgcacgatggcgatgagctggag
cgcgcattgaacaccgtcgacacgcggttggttggggtaaacaaccgcaacctgcacacc
ttcgaagtcagcctggaaaccaccctcgacctgctgccacgcattccgcgtgaccgcctg
gtgatcaccgagagtggcatcgccaaccgtgccgatgtggagctgatggaaatcaatggg
gtgtattcattcctggtaggcgagacgttcatgcgcgccgagcatcctggagcggagctg
caacggctgttcttcccggagcgtggcgtgccggttggcggatcgacactggactga

DBGET integrated database retrieval system