KEGG   Pseudomonas poae: H045_21965Help
Entry
H045_21965        CDS       T02456                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppz  Pseudomonas poae
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    H045_21965
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H045_21965
   00310 Lysine degradation
    H045_21965
Enzymes [BR:ppz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     H045_21965
    2.6.1.48  5-aminovalerate transaminase
     H045_21965
Amino acid related enzymes [BR:ppz01007]
 Aminotransferase (transaminase)
  Class III
   H045_21965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5000930..5002207
Genome map
AA seq 425 aa AA seqDB search
MSKTNASLMKRREAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGVFRALFPNELHGVS
DDDAIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKSFMKRLRELCDKHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAHYMDAIAPGGLGGTYA
GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVSGLKAIQAKYPVIGEVRALGAMIALEL
FEDGDSHKPNAAAVAAVVAKARDKGLILLSCGTYGNVLRVLVPLTSPDEQLDKGLAIIEE
CFSEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgcttccctgatgaaacgccgcgaagccgctgtaccacgcggtgtg
ggccagattcacccgatcttcgccgagtccgcgaagaacgccaccgtaaccgacgttgaa
ggtcgcgagttcatcgacttcgccggcggtatcgccgtgctgaacaccggccacgtgcac
ccgaaaatcatcgcggccgtgaccgagcaactgaacaagctgacgcacacctgcttccag
gtgctggcgtacgagccgtacgtggagttgtgcgaaaaaatcaacgccaaggtgccgggg
gatttcgacaagaaaaccttgctggtcaccaccggttccgaagccgttgagaacgccgtg
aagatcgcccgcgctgccaccggccgtgccggcgtgatcgccttcaccggcgcttaccac
ggccgcaccatgatgaccctgggcctcaccggcaaagtcgtgccgtactcggccggcatg
ggcctgatgcccggcggtgtgttccgcgcgctgttcccgaacgaactgcacggcgtgagc
gacgacgacgccatcgccagcatcgagcgcatcttcaagaacgatgccgagccgcgtgat
atcgccgccatcatcatcgagccggtgcagggtgagggcggtttctacgtcgcgcccaag
tccttcatgaagcgtctgcgcgaactgtgcgacaagcacggcatcctgctgatcgccgac
gaagtgcaaaccggcgctggccgtaccggcaccttcttcgccatggaacagatgggcgtt
gccgccgacctgaccaccttcgccaagtccatcgccggcggtttcccgctggccggtgtg
tgcggcaaggcgcactacatggacgccatcgccccaggcggcctgggcggcacctacgcc
ggcagcccgattgcctgcgcggctgcgctggcggtgatggaggtgttcgaggaagagcac
ctgctggaccgttgcaaagcggtgggtgagcgtttggtgagcggcctcaaggcgatccag
gccaagtacccggtgatcggtgaagtgcgcgccctgggcgcgatgatcgcgctggaactg
ttcgaagacggcgacagccacaagccgaacgccgcagcggtcgccgccgtggtggccaag
gcgcgggacaagggcctgatcctgctgtcctgcggcacctacggcaacgtgttgcgcgtg
ctggtaccgctgacctcgccggacgagcaactggacaagggcctggcgatcatcgaagag
tgtttctccgagctctga

DBGET integrated database retrieval system