KEGG   Cutibacterium avidum: PALO_00600Help
Entry
PALO_00600        CDS       T02632                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pra  Cutibacterium avidum
Pathway
pra00860  Porphyrin and chlorophyll metabolism
pra01100  Metabolic pathways
pra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PALO_00600
Enzymes [BR:pra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PALO_00600
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PALO_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox_3 HI0933_like FAD_binding_3 Lycopene_cycl AlaDh_PNT_C NAD_binding_9 Thi4 GIDA TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGJ76751
Position
complement(126807..128180)
Genome map
AA seq 457 aa AA seqDB search
MAIIGAGMTGLAAAHQLRSHGCRVVVLEAGPSVGGQVSSRRFGADMVEMGAEAVPLRAPG
VSDLVSELGLTDSMRHPAPGRTLLSSRRGVVEMPAGVTPVGPTKLLPTITSRILSPIGLL
RAGLEPFTSRPHPDDVSVGQFISERFGDEVGRAVVDPLLGGIHAADVDSFSLAVAAPALR
QTVRKGESIVTGTLKRNAVATWSRIRHRPQPSGPRTPATATWERGLVTLPEALAGGLTVH
TNTRATGIRQVGHEWVVTVTGPRGIGSVAADDVIIATPARVAAALLSTTHPDASELLSRC
ESTTVATLVVRTDQVDHPITTAQTWFIGSEWSPLVRQVTNLSTKWHLSEPTLRIAMGRHG
GTPIDDLSDDDLVTMTMAELERLGLSVHPHDHVIERHRGAMPQPVPGHRERMATLATVLD
DTGLHVGGAGIDGAGVGTAIVAGRRLARQITSKEEEK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatcatcggtgccgggatgacaggtctggcagccgcacaccagctgcggagccac
ggttgccgagtcgtcgtcctggaagcaggaccgagcgtcggcggacaggtcagttcccgt
cggtttggggccgacatggtcgagatgggagccgaggccgtaccgctgcgtgccccaggc
gtctccgatctggtgtcggagctggggctgacggactcgatgcgtcatcccgcccccgga
cgcaccttgctgtcgagccgacgcggggtcgtggagatgccggccggagtgacgccggtc
gggcccacgaaactcctaccgacgatcacctcgcggatcctctctcccatcggcctgctg
cgagccggcctggagcccttcacctcccgcccacaccctgacgacgtcagcgtcggccag
ttcatctcggaacgatttggcgacgaggtaggccgggccgtcgtcgatcccctgttgggt
ggcattcacgccgccgacgtcgacagcttctccctcgcggtcgcggctccggccttgagg
cagaccgtcaggaagggtgagtccatcgtcacggggaccctcaagcgcaacgcggtcgcg
acatggtcgcgcattcgtcatcgtcctcagccctccggaccccgcacccctgccaccgcg
acgtgggaacgcggtttggtgacgctgccggaggcgctggctggaggcctcaccgtgcac
acgaacacccgtgccacaggaatccggcaggttggccacgaatgggtcgtcaccgtcaca
ggaccgcgaggaatcggatcagttgccgccgatgacgtcatcatcgccacgcccgccagg
gtcgctgcagctctgctgtccaccacacaccccgatgcctcggagttgctgtcccggtgt
gagagcaccacggttgccacgctcgtggtgcggactgaccaggtggatcacccgatcacc
acggctcagacgtggttcatcggctcggaatggtccccgttggtacgccaggtgacgaat
ctctcgacgaagtggcatctctccgagcccactctccggatcgccatgggtcgtcacggt
ggaacccccatcgacgacctctccgacgacgacctcgtcaccatgaccatggctgaactg
gagcgtctaggattgagtgttcaccctcacgaccacgtcatcgagcgccaccgtggcgcc
atgccgcagccagtccccggccaccgggagcgcatggccacactcgccaccgtccttgac
gacaccggactccacgtcggcggggccgggatcgacggcgccggagtcggcaccgccatc
gtcgccggtcgacgtcttgcccgtcagatcacctcgaaggaggaggaaaagtga

DBGET integrated database retrieval system