KEGG   Propionibacterium avidum: PALO_02530Help
Entry
PALO_02530        CDS       T02632                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pra  Propionibacterium avidum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PALO_02530
Enzymes [BR:pra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PALO_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544235..546343
Genome map
AA seq 702 aa AA seqDB search
MSLTDPHLTTLADYFGIARDYHDWKGQYIEVEEATVIAVLAGLGIDASTPELAEQACREV
ANRTWRRVLPGIVVLREGQEGRVDVHVNAGEWVDVHIICEDGHHRECWQVDNWTPDRQVE
GRWIGEATFGIPADLPLGYHTIVATTADHRATSTLVVSPNWLGLPRSMGSSRVWGHAVQL
YSTRSRGSWGMGDLADLADLSTWAATQGADYMLVNPLHASQVVSPIEPSPYLPCSRLFLN
PLYVRPEIIPEFADLDSYECSKARSAQAHAAATTETIDRDRSWDSKLPVLEAVHALGLEG
SRELSYQAFRRLRGTRLVDLATWCALTEVYGNDWHEWPEGFQRPSNRAVSEFVRAHEDRV
DFFMWLQWIADQQLSAAQSAGRDAGMSLGLICDLAVGVSGAGADAWMLGKLFADGVSVGS
PPDAFNQAGQEWGQPPMRPDMLADMAYQPFREMVRAALRHAGGIRIDHILGLFRLWWVPA
GLGPCMGTYIRYDHEAMVGILALEAYRAGALVVGEDLGTVEPWVRTYLRERGIMGTSVLW
FENGEDGHPLAPEQWREYAMSSVTTHDLPPTTGYLAGDHVEVRNELGLLTESLEHERAEA
ARQTETWIGILRARGVLEGDDPSEEEIVVAMHRMLTQTPAKVLNATLTDAVGDRRTQNLP
GTTNEYPNWRVPLSHPDGSPMWLEEVFTDERAARLSRVMNEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagatccccacttgacgaccctggccgattacttcggcatcgctcgtgac
taccacgactggaagggccagtacatcgaggttgaggaggcgaccgtcatcgccgtcctt
gccgggctcgggatcgatgcgtcgaccccggagctggccgaacaggcatgccgagaggtc
gccaaccgcacctggcgtcgtgtcctgcccggaatcgtcgtgctgcgcgagggccaggaa
ggacgcgtcgacgtccacgtcaatgccggggagtgggtcgatgttcacatcatctgtgag
gacggtcatcatcgcgagtgttggcaggtcgacaactggaccccggatcgccaggtcgag
gggcgctggatcggtgaggccaccttcggcatcccggctgaccttccgctgggttaccac
accatcgtcgcgacgacggctgatcaccgcgccacgtcgaccctggtggtttccccgaac
tggctcggtctgccgaggtcaatgggttcgtcccgggtctggggccatgcggtgcagctg
tactccacgcggtctcgggggtcgtggggaatgggcgatctagcggatctggcggatctg
tccacctgggcggcaacccagggtgcggactacatgctcgtcaacccattgcatgccagc
caggttgtctccccgatcgagccctcaccgtatctgccctgcagccgtctcttcctcaac
ccgctgtacgtgcgccctgagatcattcctgagttcgcagacctcgactcctacgagtgt
tccaaggcccgctccgcccaggctcatgcggccgcgaccactgagacgatcgaccgtgac
cgttcctgggattccaagctgccggtcctcgaggccgtccacgccctcggtctggaaggg
tcgcgagagctgtcctaccaggccttccgcaggctgcgcggcacccgtctggtcgatctg
gccacctggtgtgcgctgaccgaggtctacggcaacgactggcatgaatggcccgaaggg
ttccaacgtcccagcaaccgagccgtctcggagttcgtgcgcgctcacgaggatcgcgtc
gacttcttcatgtggctgcagtggattgctgaccagcagctctcggccgcccagtcggcc
ggacgtgacgccgggatgtccctgggcctcatctgtgacctggccgtcggcgtctcgggt
gccggagcagatgcgtggatgctcgggaaactctttgccgacggtgtctccgtcggctcc
ccgcctgatgccttcaaccaggccggtcaggagtggggtcagccgccgatgcgtccggac
atgttggccgacatggcctaccagcccttccgtgagatggtgcgggcggccctgcgacat
gcgggcggtatccgtatcgaccacatccttggcctgttccggctgtggtgggtcccagcc
ggtcttggcccgtgcatgggaacgtacatccggtacgaccacgaggccatggtcggtatc
ctggccctggaggcctaccgtgccggcgccctcgtcgtgggcgaggacctgggcaccgtc
gagccgtgggtgcgcacgtatctgcgtgagcgggggatcatgggtacctcggtgctgtgg
ttcgagaatggcgaggacggccatccgctggctcccgagcagtggcgtgagtacgccatg
agttcggtgaccactcatgacctcccgcccaccaccggctacctcgctggtgaccatgtc
gaggtgcgtaacgagctcggactgctcacagagtccttggagcacgagcgggccgaggca
gcccgtcagacggagacctggatcggcatcctgcgggcgcgtggagtgttggagggggac
gatccctcggaggaagagatcgtggtggcgatgcaccgcatgctcacccagacgccggct
aaggtcctcaacgccaccctcaccgatgccgtgggggatcgacgtacccagaaccttccc
ggcactaccaatgagtacccgaactggcgggtgcctctcagccatccggacggctcgccg
atgtggctcgaggaggtcttcaccgatgagagggccgcgcgactgtctagggtcatgaac
gagaagtga

DBGET integrated database retrieval system