KEGG   Propionibacterium avidum: PALO_03850Help
Entry
PALO_03850        CDS       T02632                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pra  Propionibacterium avidum
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pra00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PALO_03850
Enzymes [BR:pra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PALO_03850
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PALO_03850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848647..849492
Genome map
AA seq 281 aa AA seqDB search
MPELPEVETVRAGLEILVIPSVVERVDVVDVRGLRTTGGSEEARTFETILTGRQFTAINR
RGKYLWFVLDDGTAMLAHLGMSGQFRVVDREAPRHRHTRVVIGLGDDRDLRFLDQRTFGG
LTLAPLVDDVPGPVAHIAPDPFEDSFGVDEVARRLRARRSTIKRSLLDQTLVSGIGNIYA
DETLWRVRRHPETPCSRLSQRKAVELLETAREVMSEAITQGGTSFDALYVNVNGESGYLY
RTLDVYGRQGKECRRRCTVIVRESFANRSSHRCPRCQRSRR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagcttcctgaggtcgagacggtgcgagccggactcgagatcctcgtcatcccc
tccgtcgtcgagcgtgtcgacgtcgtcgatgtccgcggtttgcgcacaaccggtggttca
gaagaagccagaaccttcgagacgattctgactggtcgccagttcaccgccatcaatcgc
cggggcaagtacctgtggttcgtcctcgacgacggcacggcgatgctggcccacctaggg
atgagcggacagttccgtgtcgtcgacagggaagccccacggcatcgccatacccgtgtt
gtcattggccttggtgacgaccgtgacctacgttttctggatcagcgcaccttcggcgga
ctcactctcgccccgctggttgacgatgtgcccggcccagtcgcccacatcgcccctgat
cccttcgaggattcctttggcgtcgatgaggttgcgcgacgactgcgcgcacgcaggtcg
accatcaagcgcagcctgctcgaccagacactggtatccggtatcggcaacatttatgcc
gacgaaaccctgtggcgggttcgtcgtcacccggagaccccgtgctcgcgcctcagccag
cgcaaggctgtggagttgttggagacagctcgtgaggtgatgtccgaggcgattacccag
ggtgggacatcctttgatgccctgtacgtcaatgtcaatggtgagtcgggttacttatat
cggacccttgacgtgtacggacgccagggcaaggaatgtcgacgtcgctgcaccgtcata
gttcgggagtccttcgcgaacaggtcgtcgcaccggtgcccccggtgtcagcgctcgcgt
cggtga

DBGET integrated database retrieval system