KEGG   Propionibacterium avidum: PALO_05370Help
Entry
PALO_05370        CDS       T02632                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pra  Propionibacterium avidum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pra00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1186346..1188118
Genome map
AA seq 590 aa AA seqDB search
MTHSSYTPAEEIPETLAPTGALGLTSAQLQARLDAIHPVGSIDRTETEWFRTAVFYEVLV
RSFKDSNGDGIGDFKGLTEKLDYLQWLGVDCLWLPPFYDSPLHDGGYDIRDYRWIREELG
TIEDFKVFLDAAHDRGLRVIIDFVMNHTSDSHPWFQSSRADPDGPYGNYYVWADTDEAYS
DARIIFCDTEDSNCSWDSERKQFYWHRFFHHQPDLNFEEPRVMEEMLDAVRFWMDLGIDG
FRLDAVPYLIEAEGTSCENLPGTHKILKQLRAMVDEEYPGRILLCEANQWPDDVVEYFGD
GDECQMAFHFPVMPRLYMGLRRGSRECISEILASTPDIPAGCQWGTFLRNHDELTLEMVT
EDDRQYMWEEYAPEPRWRCNLGIRRRLSPLVDNDEARVRLLNAMLLSLPGSPVLYYGDEI
GMGDDPWLPDRDGVRTPMQWDDSETAGFSTALPEDFHLPLIRTFGHGPEHVNVARQMDDP
SSLLVWTRAMLGIRRRHPVFGTGEFTDLEAEDMAVMSFLRHDEDETILCLANLSDTDRTV
TLILPQFAGVTGASLIHGQDAQPVEADGTLTVPMPPYGYRWLQMTGEEKP
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcctcctacactcccgccgaggagattcccgagaccctggcaccgaccggg
gccctcgggctcacctcggcccagttgcaggccaggctcgacgcgatccacccggtcggt
tccatcgatcggacggagaccgagtggttccgcaccgcggtgttctacgaggtcctggtg
cgatccttcaaggactccaacggagacggcatcggcgacttcaagggtctgacggagaag
ctcgactatctgcagtggctgggagtggactgcctgtggcttccgcccttctacgactcc
cccctgcacgacggcggttacgacatccgcgactaccgctggatccgtgaggagttggga
acgatcgaggacttcaaggtcttcctcgacgccgctcacgaccgtggcctgcgcgtcatc
atcgacttcgtcatgaaccacacctcggactcccacccgtggttccagtcctcgcgtgcc
gatcccgacggcccctacggcaactactacgtctgggccgacaccgacgaggcctattcg
gacgctcgcatcatcttctgcgacaccgaggactccaactgctcgtgggactccgagcgc
aagcagttctactggcaccgcttcttccaccaccagcccgacctcaacttcgaggagccc
cgggtcatggaggagatgctcgacgccgtccgattctggatggacctgggcatcgacggt
ttccgtctcgacgccgtcccctacctcatcgaggccgagggaacgagctgcgagaacctg
ccgggaacccacaagatcctcaaacagctgcgcgcaatggtcgacgaggagtacccggga
cgcatcctgctgtgcgaggccaatcagtggcctgacgacgtcgtcgagtacttcggtgac
ggtgatgagtgccagatggccttccacttccccgtcatgccacgcctgtacatggggctg
cgccgcggatcacgggagtgcatcagcgagatcctcgcctccacaccggacatcccggca
ggttgtcagtggggaaccttcctccgcaaccatgacgaactcaccctcgagatggtgacc
gaggatgaccgtcagtacatgtgggaggaatatgctcccgagccgcgctggcgatgcaac
ctgggcattcgtcgccggttgagccccctggtcgacaacgacgaggccagggttcgtctg
ctcaacgccatgctgctgtccctgcccggctccccggttctctattacggcgacgagatc
ggcatgggcgacgacccttggcttcctgaccgcgacggcgtgcgcaccccgatgcagtgg
gatgattccgagacggccggattctcgaccgcgctgccggaggacttccatctcccactc
atccgcaccttcggtcacggcccggaacacgtcaacgtcgcccgtcagatggatgaccca
tcctccctgttggtgtggacccgcgccatgttgggcatccgtcgtcggcaccccgttttc
ggtaccggagagttcaccgatctggaggcggaggacatggccgtgatgtccttcctgcgc
cacgacgaggacgagacgatcctgtgcctggccaatctgtcggacaccgataggaccgtc
accctcatcctgccgcagttcgcaggtgtgaccggagcgtccctcattcacggccaggat
gcccagccggtggaagccgacggaaccctgacggttccgatgccgccctacggctaccga
tggctgcagatgaccggagaggagaagccatga

DBGET integrated database retrieval system