KEGG   Propionibacterium avidum: PALO_09035Help
Entry
PALO_09035        CDS       T02632                                 

Definition
putative protoporphyrinogen oxidase, HemY
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pra  Propionibacterium avidum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PALO_09035
Enzymes [BR:pra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PALO_09035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962535..1963992
Genome map
AA seq 485 aa AA seqDB search
MNHNSEDVTMNTLDPHTVDAVVIGGGMAGLVAAWQLTQEGLRPVLVESRGYTGGLVAGST
LAGISYDIGAEGWAIRLPDTAELAEELGVTVEKPRTAPSWVYFDDACFAMPGNAILGIPA
DLSDPAVVIALGAKEAARAAALDRAPMPDELPRDLGTLVESRMGPKVLRRLVTPIAGGIH
AADPHLLSADVVSPGLRAAAQSTGSLAAGVALCRSRMPEGPVVASVAGGMFTMPAELRRQ
AEEAGARIMTRVGARKLTCHGDQWLVETADTSRNPNPSLPPVPDGEVRTFLTPRVVVACS
AGPATDLLSSVIDVSGPEMIPGAPIGHVNLALQAPELDDSPRGNGMLVAPGTTSVKAKAL
THMSAKWPSLGQSCPDGLHLLRVSYGRSGETDVELSVERALEDASILLGVELSSNQVVDS
QIIHWTGSLAPTTPETRAWRDGLHRQLEELNRSGRGRIGLVGAWASGSGIAALVPQARHT
ARQLV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccacaattccgaggacgtgacgatgaacacccttgatccgcacaccgtggacgcc
gtcgtcatcggcggtggcatggccggactcgttgcggcctggcagctcacccaggaaggg
ctacgccccgtgctggtggaatcccgcgggtacaccgggggcctggtggctgggtcgaca
ttggcggggatcagctatgacatcggcgccgaggggtgggccattcgtcttcccgacacc
gccgagctggccgaggaactgggggtgaccgtcgagaaaccgaggaccgccccgtcctgg
gtgtacttcgacgacgcctgcttcgcgatgcccggcaatgccatcctgggcattcctgcc
gatctgtcggacccggcggtcgtcattgcgctgggagccaaggaggccgcccgcgccgcc
gcactcgaccgcgccccaatgcccgacgaactcccccgggatctgggaaccctggtggag
tcacgaatgggaccgaaggtgctgaggcgactcgtcaccccgatcgccggtggtatccat
gccgccgatccgcacctgctctcggccgacgtcgtctcccccggtctgcgggctgccgcc
cagtccaccgggtccttggctgccggcgtggccctgtgccgttcccggatgccggaaggg
ccggtcgtcgcctcggtggctggcggcatgttcaccatgccggccgagctgcgtcgtcag
gccgaggaggccggtgcgaggatcatgacccgggtgggggctcgaaagctgacctgccat
ggtgaccagtggctcgtcgagaccgccgacacctcgcgcaacccgaatccgtccttgcct
cctgtccctgacggcgaggtgcgcaccttcctgaccccgcgggtcgtcgtcgcctgttct
gccggtcctgccaccgacctgctgagcagtgtcatcgacgtctccggacccgagatgatt
cccggtgcgcccattggccacgtcaatctggccctgcaggctccggagctggacgacagc
ccgcgtggaaacggcatgctggtggctcccgggacgacgagcgtcaaggcgaaggccctg
acacacatgtctgccaagtggccgagcctggggcagtcctgccccgacggactgcacctg
ctacgggtctcctacgggcgatccggggagacggatgtcgagctcagcgtcgagcgggcg
ctggaggatgcctcgatcctgctcggtgtggaattgtcgtccaatcaggtggtggactcc
cagatcatccactggacggggtctctggccccgacgactccggagaccagggcgtggcgt
gacggtctgcaccgccagctcgaggagttgaaccggtccggacgaggccgcatcggtctg
gtcggggcatgggcgtcgggttccggcatcgccgctctggtgcctcaagcccgccacacg
gcccgtcaactggtctga

DBGET integrated database retrieval system