KEGG   Pandoraea sp. RB-44: X636_15640Help
Entry
X636_15640        CDS       T02950                                 

Definition
ribulose bisphosphate carboxylase
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
prb  Pandoraea sp. RB-44
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    X636_15640
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    X636_15640
Enzymes [BR:prb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     X636_15640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3400054..3401346
Genome map
AA seq 430 aa AA seqDB search
MNRTLSATYLIETPLDPEQVAEVMAGEQSCGTFTRVAGETDALRARARATVESVERVGEA
SRASLPNAFLDRLAATDPRAGNGPWHRARVRIAFPCDNVGANLPTLAATLAGNLYDLGEV
TGMRLERVAMPSAYRRQFDFPRYGIDGTRRATGVAQGALVGTILKPNVGMRADETAALVS
RLCDAGVDFIKDDEVCANPVHAPLAERVPAVMAAVRAHRERTGKQVMVAFNITDETGEML
RHADLVQREGGNCVMVSLNWCGFSAVTTLRRHTPLAIHGHRNGYGAMSRDPMLGIGFQAY
QALWRLAGVDHMHVHGLQGKFAQPDDEVIESALDCYAPLCVDAGDGPDDRVMPAFSSGQW
AGTVPATWQALGRDDLLFMAGGGILAHPDGAGAGVQSLRDAWQAMRAGQSLDEAARHAPA
LAAAVRFFGR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggacactgagtgcgacatacctgatcgagacgccgctcgacccggagcaggtc
gccgaagtcatggccggcgagcagtcctgcggcaccttcacccgggtggcgggcgagaca
gatgcgttgcgcgcccgtgcccgcgccacggtcgagtctgtcgagcgggtgggcgaggcc
tcgcgcgcgtcgttgccgaacgcctttctcgatcgtctggccgcgacggacccgagagcg
ggcaatggaccgtggcatcgcgcacgggtgcgcatcgcgtttccgtgcgacaacgtcggg
gcgaatctgccgacgctggccgccacgctggcgggcaacctgtacgacctgggggaagtg
acgggcatgcgcctggagcgcgttgcgatgccgtcggcctatcgtcggcaattcgatttc
ccgcgctacggcatcgatggcacgcgccgggccacgggcgtggcacagggtgcgctcgtc
ggcacgatcctcaagcccaacgtcggcatgcgcgccgacgagacggccgcgctcgtttcg
cgcctgtgcgacgcgggcgtcgacttcatcaaggatgacgaggtgtgcgccaaccccgtg
catgcgccgttggccgagcgcgtgccggcggtcatggcggcagtgcgcgcgcaccgcgaa
cgcacgggcaagcaggtgatggtggccttcaacatcacggacgagaccggagagatgctg
cgtcacgccgacctcgtgcaacgcgaggggggcaattgcgtgatggtcagtctgaactgg
tgcggcttttcggcggtcacgacgctgcgtcgacatacgccgctggcgatccacggccat
cggaacggctacggcgccatgtcgcgcgacccgatgctaggcatcggcttccaggcctat
caggcgctctggcggctcgcgggcgtggatcacatgcacgtgcacggtctgcaaggcaag
ttcgcgcagcccgatgacgaggtcatcgaatccgcgcttgattgctatgccccgctttgc
gtcgatgcgggcgacggcccggacgatcgcgtcatgcccgctttttcttccggtcagtgg
gccggcacggtgcccgcgacctggcaggcgcttgggcgcgacgacctgctcttcatggcg
ggaggcggcattctcgcgcatcccgacggggcgggcgccggcgtgcagagcctgcgcgac
gcgtggcaggcgatgcgcgccgggcagtcgctcgatgaagcggcacgccatgcgcccgcg
ctggccgccgccgtgcgcttcttcgggcgctga

DBGET integrated database retrieval system