KEGG   Pandoraea pnomenusa: X636_17780Help
Entry
X636_17780        CDS       T02950                                 

Definition
(GenBank) hypothetical protein
  KO
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
prb  Pandoraea pnomenusa
Brite
Enzymes [BR:prb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     X636_17780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1581696..1582565
Genome map
AA seq 289 aa AA seqDB search
MFQEDIFYKGGEHAVLLLPGLSSTPLEMRPVAKALQRDGYTVSVPHIAGYGLGSPCTDWR
AWIEAARAKFRALRETHETVSICGLSMGATLSLAVAQAEPDVTALSLLAVTLVYDGWTIP
WYYPLIDLVFHTPLRHRYRYQEKAPYGLKNEALRARVAKSMSLHDASEIGSASLPLAHLY
NARRLAAHVRARLERVTADCLIVHAVDDDTASPHNARIVYDGVSSEVKQKCLLGESYHIL
TMDNERETVADETRRFFRDAIARHTGTASPETRIISKALLRAKRRQAVA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggaagatatcttctacaagggcggtgagcacgccgtactgctgttgccgggg
ctctccagcacgccgctcgagatgcgtccggtggccaaggcgttgcagcgtgatggctat
accgtatcggtgccgcatattgccggttacggactcggctcgccgtgcacggactggcgc
gcctggatcgaagccgcccgcgcgaagtttcgcgcgctgcgtgagacgcacgagacggta
tcgatctgcggtctgagcatgggggccacgctgagcctggcggtcgcgcaggcggagccg
gacgtgacggcgctgtcgctgctggccgtcacgctggtgtatgacggctggaccatcccc
tggtattacccgctcatcgatctggtgtttcacacgccgctgcgccatcgctatcgctat
caggaaaaggcgccgtacgggctgaagaacgaggccctgcgcgcgcgcgtcgcgaagtcg
atgtcgttgcacgacgcctccgagatcggatcggcctcgttgcccctcgcgcatctctac
aacgcgcggcggcttgccgcgcacgttcgtgcgcgcctcgaacgcgtgacggcggactgt
ctgatcgtgcacgcggtcgacgacgatacggccagcccgcacaatgcgcgcatcgtgtac
gacggcgtgtcgtccgaagtgaagcagaagtgcctgctcggcgagagttatcacatcctc
acgatggacaacgagcgcgagaccgtggcggacgaaacacgtcggttcttccgcgacgcc
attgcccggcacaccgggaccgcgagcccggagacccgcatcatttccaaggcgctgctg
cgcgccaaacgccgtcaggccgtggcctga

DBGET integrated database retrieval system