KEGG   Pandoraea sp. RB-44: X636_17780Help
Entry
X636_17780        CDS       T02950                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
prb  Pandoraea sp. RB-44
Brite
Enzymes [BR:prb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     X636_17780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3882634..3883488
Genome map
AA seq 284 aa AA seqDB search
MFYKGGEHAVLLLPGLSSTPLEMRPVAKALQRDGYTVSVPHIAGYGLGSPCTDWRAWIEA
ARAKFRALRETHETVSICGLSMGATLSLAVAQAEPDVTALSLLAVTLVYDGWTIPWYYPL
IDLVFHTPLRHRYRYQEKAPYGLKNEALRARVAKSMSLHDASEIGSASLPLAHLYNARRL
AAHVRARLERVTADCLIVHAVDDDTASPHNARIVYDGVSSEVKQKCLLGESYHILTMDNE
RETVADETRRFFRDAIARHTGTASPETRIISKALLRAKRRQAVA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atcttctacaagggcggtgagcacgccgtactgctgttgccggggctctccagcacgccg
ctcgagatgcgtccggtggccaaggcgttgcagcgtgatggctataccgtatcggtgccg
catattgccggttacggactcggctcgccgtgcacggactggcgcgcctggatcgaagcc
gcccgcgcgaagtttcgcgcgctgcgtgagacgcacgagacggtatcgatctgcggtctg
agcatgggggccacgctgagcctggcggtcgcgcaggcggagccggacgtgacggcgctg
tcgctgctggccgtcacgctggtgtatgacggctggaccatcccctggtattacccgctc
atcgatctggtgtttcacacgccgctgcgccatcgctatcgctatcaggaaaaggcgccg
tacgggctgaagaacgaggccctgcgcgcgcgcgtcgcgaagtcgatgtcgttgcacgac
gcctccgagatcggatcggcctcgttgcccctcgcgcatctctacaacgcgcggcggctt
gccgcgcacgttcgtgcgcgcctcgaacgcgtgacggcggactgtctgatcgtgcacgcg
gtcgacgacgatacggccagcccgcacaatgcgcgcatcgtgtacgacggcgtgtcgtcc
gaagtgaagcagaagtgcctgctcggcgagagttatcacatcctcacgatggacaacgag
cgcgagaccgtggcggacgaaacacgtcggttcttccgcgacgccattgcccggcacacc
gggaccgcgagcccggagacccgcatcatttccaaggcgctgctgcgcgccaaacgccgt
caggccgtggcctga

DBGET integrated database retrieval system