KEGG   Pandoraea sp. RB-44: X636_21575Help
Entry
X636_21575        CDS       T02950                                 

Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
prb  Pandoraea sp. RB-44
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prb00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    X636_21575
   01230 Biosynthesis of amino acids
    X636_21575
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    X636_21575
   00290 Valine, leucine and isoleucine biosynthesis
    X636_21575
Enzymes [BR:prb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     X636_21575
    2.6.1.66  valine---pyruvate transaminase
     X636_21575
Amino acid related enzymes [BR:prb01007]
 Aminotransferase (transaminase)
  Class I
   X636_21575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4644099..4645325
Genome map
AA seq 408 aa AA seqDB search
MKPILKSQKLQNVCYDIRGPVLEHAKRMEDEGHRIIKLNIGNLAPFGFEPPDEIVQDMIR
NLPNSAGYSDSRGVFAARKAIMHYCQQKRIKDVQLDDIYLGNGASELIVMAMQALLNDGD
EVLVPAPDYPLWTAAVSLSGGTPVHYVCDEQADWQPDLADIRKKITPNTRAIVIINPNNP
TGALYSDELLKEIVALAREHKLIIYADEIYDKIIYDGAEHTSIASLSEDVLTITFNGLSK
SYRACGYRAGWMIVSGDKRPARDYIEGLNILASMRLCPNVPGQYAIQTALGGYQSIQDLI
VPGGRLYEQREIAHRMLTAIPGVTCVKPKAALYLFPRLDPAVYPIANDQEFILQLLLEEK
VLLVQGSGFNWMHPDHFRVVFLPHEGDLEDAISRIARFLDGYRRRHGK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgatcctcaaatcgcagaaattgcagaatgtctgctatgacattcgtgggccc
gtgctcgaacatgccaagcgcatggaagacgaaggtcatcgcatcatcaagctgaacatc
ggcaatctggcgccgttcggcttcgagccgcccgacgagatcgtgcaggacatgatccgc
aacctgccgaattcggccggctattcggactcgcggggcgtgttcgcggcgcgcaaggcg
atcatgcattattgtcagcaaaagcgcatcaaggatgtgcagctcgacgacatctacctc
ggcaacggggcgtcggagctcatcgtgatggccatgcaggcactgctcaacgatggcgac
gaggtcctcgtgcccgcgcccgactatccgctgtggacggcggcggtcagcctctcgggc
ggcaccccggtccactacgtctgcgacgaacaggcggactggcagcccgacctcgcggac
attcggaaaaagatcacgccgaacacgcgcgccatcgtcatcatcaacccgaacaacccg
accggcgcgctttactccgacgaactgctcaaggagatcgtcgcgctcgcacgcgagcac
aagctcatcatttacgccgacgagatctacgacaagatcatctacgacggcgccgagcat
acgtcgatcgcctcgttgtccgaggacgtgctcaccattaccttcaacggcctgtcgaaa
agctatcgcgcgtgcggttaccgcgcgggctggatgatcgtgtccggcgacaagcgcccg
gcgcgcgactatatcgaagggctgaacatcctggcctcgatgcggctgtgccccaacgtg
ccggggcagtacgccatccagacggcgctgggcggctaccagagcattcaggacctgatc
gtgccgggcgggcgcctgtacgagcagcgcgaaatcgcgcaccgcatgctcaccgctatt
cccggcgtgacctgcgtgaagccgaaggcggcgctgtacctgttcccgcgtctcgatccg
gcggtgtaccccatcgccaacgaccaggaattcatcctccagttgctgctcgaagaaaag
gtcctgctggtgcagggcagcggtttcaactggatgcaccccgaccatttccgtgtcgtg
ttcctgcctcacgagggcgacctggaagacgccatcagtcgcattgcccgcttccttgac
ggttatcgccgtcgccacggcaagtga

DBGET integrated database retrieval system