KEGG   Pseudomonas resinovorans: PCA10_01250Help
Entry
PCA10_01250       CDS       T02708                                 

Definition
putative 5-aminovalerate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pre  Pseudomonas resinovorans
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PCA10_01250
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCA10_01250
   00310 Lysine degradation
    PCA10_01250
Enzymes [BR:pre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PCA10_01250
    2.6.1.48  5-aminovalerate transaminase
     PCA10_01250
Amino acid related enzymes [BR:pre01007]
 Aminotransferase (transaminase)
  Class III
   PCA10_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142659..143936
Genome map
AA seq 425 aa AA seqDB search
MSKNETLLKRRAAAVARGVSQIHPIVAERAENATVWDVDGREYIDFAGGIAVLNTGHLHP
KVVAAVQEQLTKLTHTCFQVLAYEPYIELCEEIAKRVPGDFAKKTLLVTSGSEAVENAVK
IARAATGRAGVIAFTGAYHGRTMMTLSLTGKVVPYSAGMGLMPAGVYRAVAPCELHGVSE
DESIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKAFMQRLRALCDQHGILLIADE
VQTGAGRTGTFFATEQLGVVPDLTTFAKSVGGGFPISGVVGKAEIMDSIAPGGLGGTYAG
SPIACAAALAVLKVFDEEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMIAIELF
EGGDESKPAAELVGKIVAKAREKGLILLSCGTYYNVIRFLMPVTIPDAQLDKGIAIVAEC
FDELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacgaaaccctgctgaaacgccgtgccgccgctgtcgcccgcggtgtcagc
cagatccacccgatcgtcgccgagcgcgccgaaaacgccaccgtctgggacgtcgacggt
cgcgagtacatcgacttcgccggcggcatcgccgtactgaacaccggccacctgcacccg
aaagtggtcgctgccgtacaagagcagctgaccaagctgacccacacctgcttccaggtg
ctggcgtacgagccctacatcgagctctgcgaagagatcgccaagcgcgtaccgggtgac
ttcgccaagaagaccctgctggtgacctccggctccgaagccgttgagaacgccgtgaag
atcgcccgtgccgccaccggccgcgccggcgtgatcgccttcaccggcgcctaccacggc
cgcaccatgatgaccctgtccctgaccggcaaggtcgttccgtactccgccggcatgggc
ctgatgcccgcaggcgtgtaccgcgccgtggctccgtgtgaactgcacggcgtgagcgaa
gacgagtccatcgccagcatcgagcgcatcttcaagaacgatgcccagccccaggacatc
gcggccatcatcatcgagccggttcagggcgagggtggcttctacgtcaactccaaggcc
ttcatgcagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgacgaa
gtacagaccggcgctggccgtaccggcaccttcttcgccaccgagcagctgggcgtagtg
cctgacctgaccaccttcgccaagtccgttggcggcggcttcccgatttcgggcgtcgtc
ggcaaggccgaaatcatggacagcatcgctcccggcggcctgggcggcacctatgccggc
agcccgatcgcctgcgccgcggccctggccgtgctgaaagtgttcgacgaagagaaactg
ctggagcgcagccaagccgtgggcgaacgcctgaaggccggcctgcgtgaaatccaggcc
aagcacaaggtcatcggtgacgtccgtggcctgggttcgatgatcgccatcgagctgttc
gaaggcggcgacgaaagcaagccggccgccgaactggttggcaagatcgttgccaaggca
cgcgagaagggcctgatcctgctgtcttgcggtacctactacaacgtcatccgcttcctg
atgccggtcaccattcccgacgcgcaactggacaagggcatcgccattgtcgccgagtgc
ttcgacgaactggcctga

DBGET integrated database retrieval system