KEGG   Pseudomonas resinovorans: PCA10_02510Help
Entry
PCA10_02510       CDS       T02708                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pre  Pseudomonas resinovorans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pre03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275579..276391
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGIAPFLEGQRVSRVIVRERRLRWPIPEDLDVRLSGQRILVVERRAKYL
LLGAEAGTLISHLGMSGSLRLVEAGLAAAKHEHVDIELESGLALRYTDPRRFGAMLWSSD
PLNHELLRNLGPEPLTELFDGERLFQLSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAA
GVDPRREAGSISRARYLALATEIKRILAQAIECGGTTLRDFVGGDGKPGYFQQELFVYGR
GGEFCKQCGSTLREIRLGQRASVYCPRCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagtcgaaaccacccgccgtggcatagcgcccttcctcgaaggg
cagcgcgtcagccgggtgatcgtgcgcgagcgccgcctgcgctggccgatccccgaggac
ctggatgtgcgcctgtccggccagcgcatcctggtggtggagcggcgcgccaagtacttg
ttgctgggggccgaggccggcacgctgatcagccacctcggcatgtccggcagcctgcgc
ctggtggaagccgggctggctgcggccaagcacgagcatgtggatatcgagctggagtcg
ggcctggccctgcgctacaccgatccgcgccgcttcggggcgatgctctggagcagcgat
ccgctcaaccacgaattgctgcgcaacctggggccagagccgctgaccgaactgttcgac
ggcgagcgcctgttccagctgtcccgtggccgcagcatggcggtcaagcccttcatcatg
gacaacgcagtggtggtgggcgtcggcaacatctacgccagcgaggcgctgttcgccgcc
ggcgtcgatccgcgccgcgaggccggcagcatctcccgggcgcgctacctggcgctggcc
acggagatcaagcggatcctcgcccaggccatcgagtgcggcggtaccaccctgcgcgat
ttcgtcggtggcgacggcaagccgggctacttccagcaggaactgttcgtctacggccgg
ggtggcgagttctgcaaacagtgcggctcgaccctgcgggagatccgcctgggccagcgc
gccagtgtctactgcccccgttgccaacgctga

DBGET integrated database retrieval system