KEGG   Pseudomonas resinovorans: PCA10_13830Help
Entry
PCA10_13830       CDS       T02708                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00362  Benzoate degradation
pre00620  Pyruvate metabolism
pre00621  Dioxin degradation
pre00622  Xylene degradation
pre00650  Butanoate metabolism
pre01100  Metabolic pathways
pre01120  Microbial metabolism in diverse environments
pre01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCA10_13830
   00650 Butanoate metabolism
    PCA10_13830
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PCA10_13830
   00622 Xylene degradation
    PCA10_13830
   00621 Dioxin degradation
    PCA10_13830
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PCA10_13830
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     PCA10_13830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAN47115
UniProt: S6AGH0
Position
1480874..1481782
Genome map
AA seq 302 aa AA seqDB search
MSKKLKAAIIGPGNIGTDLLIKMRRSEWIEPVWMVGVDPTSEGLRRAAEFGLKTTAGGVD
GLLPHVLDDDIRIAFDATSAYVHAENSRKLNELGVIMIDLTPAAIGPYCVPPVNLKEHAE
TLALNVNMVTCGGQATIPMVAAVSRVQPVEYGEIVATVSSRSVGPGTRQNIDEFTRTTAG
AVEKIGGAKRGKAIIVINPAEPPLMMRDTIHCLTEGEPDQAEIRASVLHMVKEVQRYVPG
YKLINGPVFDGRKVSIFIEVEGLGDFLPKSAGNLDIMTAAGLRTAEMFAEEAHKGALTLP
AR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaactcaaggcggccatcatcgggccgggcaatatcggcaccgatctgctg
atcaagatgcgccgttcggaatggatcgagccggtgtggatggtgggcgtggacccgacc
tcggagggcctgagacgcgccgccgagttcggcctgaaaaccacggcgggcggcgtcgac
ggcctgctgccccatgtgctggacgacgacatccgcatcgccttcgacgccacctcggcc
tatgtgcacgccgagaacagccgcaagctcaatgagctgggggtgatcatgatcgacctc
accccggcggccatcggcccctactgcgtgccgccggtcaacctcaaggagcacgccgaa
accctcgcgctgaacgtcaacatggtcacctgcggcggccaggccaccatcccgatggtg
gcggcggtgtcccgggtgcagccggtggaatacggcgagatcgtcgccacggtgtcgtcc
cgctcggtgggcccgggcacccggcagaacatcgacgagtttacccgcaccaccgccggc
gccgtggagaagatcggcggtgccaagcgcggcaaggcgatcatcgtgatcaacccggcc
gagccgccgctgatgatgcgcgacaccatccattgcctcaccgaaggcgagccggaccag
gcggaaatccgcgcctcggtgctgcacatggtcaaggaggtgcagcgctacgtaccgggc
tacaagttgatcaacggcccggtgttcgacggccgcaaggtgtcgatcttcatcgaggtg
gaagggctgggggatttcctgcccaagtccgccggcaacctggacatcatgaccgccgcc
ggcctgcgcaccgccgagatgttcgccgaagaagcccacaagggcgccctcacgctcccc
gcccgctga

DBGET integrated database retrieval system