KEGG   Pseudomonas resinovorans: PCA10_13830Help
Entry
PCA10_13830       CDS       T02708                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
pre  Pseudomonas resinovorans
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PCA10_13830
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCA10_13830
   00650 Butanoate metabolism
    PCA10_13830
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PCA10_13830
   00622 Xylene degradation
    PCA10_13830
   00621 Dioxin degradation
    PCA10_13830
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PCA10_13830
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     PCA10_13830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1480874..1481782
Genome map
AA seq 302 aa AA seqDB search
MSKKLKAAIIGPGNIGTDLLIKMRRSEWIEPVWMVGVDPTSEGLRRAAEFGLKTTAGGVD
GLLPHVLDDDIRIAFDATSAYVHAENSRKLNELGVIMIDLTPAAIGPYCVPPVNLKEHAE
TLALNVNMVTCGGQATIPMVAAVSRVQPVEYGEIVATVSSRSVGPGTRQNIDEFTRTTAG
AVEKIGGAKRGKAIIVINPAEPPLMMRDTIHCLTEGEPDQAEIRASVLHMVKEVQRYVPG
YKLINGPVFDGRKVSIFIEVEGLGDFLPKSAGNLDIMTAAGLRTAEMFAEEAHKGALTLP
AR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaactcaaggcggccatcatcgggccgggcaatatcggcaccgatctgctg
atcaagatgcgccgttcggaatggatcgagccggtgtggatggtgggcgtggacccgacc
tcggagggcctgagacgcgccgccgagttcggcctgaaaaccacggcgggcggcgtcgac
ggcctgctgccccatgtgctggacgacgacatccgcatcgccttcgacgccacctcggcc
tatgtgcacgccgagaacagccgcaagctcaatgagctgggggtgatcatgatcgacctc
accccggcggccatcggcccctactgcgtgccgccggtcaacctcaaggagcacgccgaa
accctcgcgctgaacgtcaacatggtcacctgcggcggccaggccaccatcccgatggtg
gcggcggtgtcccgggtgcagccggtggaatacggcgagatcgtcgccacggtgtcgtcc
cgctcggtgggcccgggcacccggcagaacatcgacgagtttacccgcaccaccgccggc
gccgtggagaagatcggcggtgccaagcgcggcaaggcgatcatcgtgatcaacccggcc
gagccgccgctgatgatgcgcgacaccatccattgcctcaccgaaggcgagccggaccag
gcggaaatccgcgcctcggtgctgcacatggtcaaggaggtgcagcgctacgtaccgggc
tacaagttgatcaacggcccggtgttcgacggccgcaaggtgtcgatcttcatcgaggtg
gaagggctgggggatttcctgcccaagtccgccggcaacctggacatcatgaccgccgcc
ggcctgcgcaccgccgagatgttcgccgaagaagcccacaagggcgccctcacgctcccc
gcccgctga

DBGET integrated database retrieval system