KEGG   Pseudomonas resinovorans: PCA10_20570Help
Entry
PCA10_20570       CDS       T02708                                 

Gene name
gdhB
Definition
NAD(+)-dependent glutamate dehydrogenase (EC:1.4.1.2)
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
pre  Pseudomonas resinovorans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PCA10_20570 (gdhB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCA10_20570 (gdhB)
   00330 Arginine and proline metabolism
    PCA10_20570 (gdhB)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PCA10_20570 (gdhB)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     PCA10_20570 (gdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2243050..2247912
Genome map
AA seq 1620 aa AA seqDB search
MAFFTAASKADFQHQLQAALAQHVSEQALPQVSLFAEQFFGIIALEELTQRRLSDLVGCT
LSSWRLVERFDAASPEVRVFNPDYEKHGWQSTHTAVEVLHPDIPFLVDSVRMELNRRGYS
IHTLQNNVISVRRNAKGELQEILPKGTQGKDVRQESLMFLEIDRCANNGAMKTLEKALLE
VLGEVRVAVADFKPMKAKAQELLAWLDKAKLKVDGDELKEVKVFMEWLLDNHFTFLGYEE
FTVADDKNGGHLVYDEKSLLGVSKLRRAGLKKDDLHIEAEALNYLRGPMLLSFAKAAEPS
RVHRPAYPDFVSIRELDAKGKVIKECRFMGLYTSAVYAESVNHIPYIRHKVAEIQHRSGF
ASGAHLGKELAQVLEVLPRDDLFQTPVDDLFNTAMSIVQMQERNKIRLFLRRDPYGRFAY
ALAYVPRDVYSTETRLKIQQILMDRLQASDCEFWTFFSESVLARVQFILRLDPKNKLHVD
TALLEKEVIQACRSWKDDYASLVNESFGEGQGTRVLADFPKGFPAGYRERFAPHSAVVDM
QHLHSLSDERPLVMSFYQPLAQGEQQLHCKLYHADTPLALSDVLPILENLGLRVLGEFPY
RLVRQDGRQYWIHDFAFTSALGDEVDLQQLNDTLQDAFVHIVGGHAENDAFNRLVLTAAM
PWRDVALLRAYARYLKQIRLGFDLSYIASTLLNHANIAKELVRLFKTRFYLARKLAADDL
EDKQQKLEQAILGELDNVAVLNEDRILRRYLDLIKATLRTNFYQPDAAGQNKSYFSFKLS
PRQIPDIPRPVPKFEIFVYCPRVEGVHLRFGDVARGGLRWSDREEDFRTEVLGLVKAQQV
KNAVIVPMGAKGGFIPRRLPVGGTRDDIQNEAIACYRIFISGLLDVTDNLKEGKVVPPAN
VVRHDADDPYLVVAADKGTATFSDIANGIAQDYGFWLGDAFASGGSAGYDHKGMGITAKG
GWVSVQRHFRERGIDVQKDHVTVIGIGDMAGDVFGNGLLLSDKLQLVAAFNHMHIFIDPN
PDAASSFVERKRLFDLPRSSWADYDAKLISEGGGIFLRSAKSIAISPQMQQRFEIEADKL
PPTELLHALLKSPVDLLWNGGIGTYVKASSESHADVGDKANDALRVDGRELRAKVVGEGG
NLGMTQLGRVEYGLNGGASNTDFIDNAGGVDCSDHEVNIKILLNEIVGAGDMTGKQRNKL
LAEMTDDVGNLVLGNNYKQTQALSLAQRRAREKIGEYKRLITALEAAGKLDRGLEFLPTD
DELNERIAVGQGLTRPELAVLISYSKIDLKESLLKSLVPDDDYLAQEMETAFPARLAETF
GESMRRHRLKREIISTQIANDLVNHMGITFVQRLKESTGMSAANVAGAYVVVRDVFRLSH
WWQQIEALDYKVPAELQLTLMDELMRLGRRATRWFLRSRREDQNAARDVNHFAPRVEALA
GRLDELLEGPSREQWLARFQSYVEAGAPEELARVVAGTSHFYTLLPIIEASDVTGKDTAD
VAAAYFAVGGALDLSWYLQQITSLPVENNWQALAREAFRDDLDWQQRAITISVLQMNEGP
VEIEERVALWLDQHRVLVERWKAMLVELRAATTTDYAMYAVANRELMDLAQSGQHGVCIL
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcttcacggcggccagcaaagccgacttccagcaccaactgcaagcggccctg
gcgcagcacgtcagcgaacaggcattgccacaagtttccctgttcgccgaacaattcttc
ggcatcatcgcgcttgaggagctgacccagcgtcggctgtccgacctggtcggctgcacc
ctctcgtcctggcgcctggtggaacgcttcgacgccgccagcccggaagtgcgggtgttc
aaccccgactacgagaagcacggctggcagtccacccacaccgccgtcgaagtgctgcac
ccggacatccccttcctggtggactcggtgcgcatggagctgaaccgtcgcggctacagc
atccataccctgcagaacaacgtcatcagcgtgcgtcgcaacgccaagggcgagctgcag
gaaatcctgcccaagggcacccagggcaaggacgtgcgccaggaatcgctgatgttcctg
gagatcgaccgttgcgccaacaacggcgccatgaagaccctggagaaggccctgctggaa
gtgctgggcgaggtccgcgtggccgtggccgacttcaagccgatgaaggccaaggcccag
gagctgctggcctggctggacaaggccaagctcaaggtcgacggcgacgagctgaaggaa
gtgaaggtgttcatggagtggctgctggacaaccacttcaccttcctcggctacgaggaa
ttcaccgtggccgacgacaagaacggcggccacctggtctatgacgagaaatccctgctg
ggtgtttcaaagctgcgtcgcgccggcctgaagaaggacgacctgcacatcgaggccgag
gccctgaactacctgcgcgggcccatgctgctgtcgttcgccaaggccgccgaaccgagc
cgcgtgcaccgcccggcctacccggacttcgtctccatccgcgagctggatgccaagggc
aaggtgatcaaggagtgccgcttcatgggcctctacacctccgccgtgtatgccgagagc
gtcaaccacatcccctacatccgccacaaggtggccgagatccagcaccgctcgggcttc
gcctccggcgcccacctgggcaaggaactggcccaggtgctggaagtgctgccgcgcgac
gacctgttccagaccccggtggacgacctcttcaacaccgccatgtccatcgtgcagatg
caggaacgcaacaagatccgcctgttcctgcgccgcgacccctatggccgcttcgcctat
gccctggcctacgtgccgcgcgatgtctattccaccgagacccgcctgaagatccagcag
atcctgatggatcgcctgcaggccagcgactgcgagttctggaccttcttctccgagtcg
gtgctggcccgcgtgcagttcatcctgcgcctggacccgaagaacaagctgcacgtcgat
accgcactgctggagaaggaagtcatccaggcctgccgttcctggaaggacgactacgcc
agcctggtcaacgaaagcttcggcgaggggcagggcacccgcgtgctggccgacttcccg
aaaggcttcccggccggctaccgcgaacgcttcgccccgcactcggcggtggtggacatg
cagcacctgcacagcctctccgacgagcgcccgctggtgatgagcttctaccagccgctg
gcccagggcgagcagcagctgcactgcaagctgtaccacgccgataccccgctggccctg
tccgacgtgctgccgatcctggagaacctcggcctgcgcgtgctgggtgagttcccctac
cgcctggtgcgccaggacggtcgccagtactggatccacgacttcgccttcaccagcgcc
ctgggcgacgaggtcgacctccagcaactcaacgacaccctgcaggacgccttcgtccac
atcgtcggcgggcatgccgagaacgacgccttcaaccgcctggtgctgaccgccgccatg
ccctggcgcgacgtggcgctgctgcgcgcctacgcccgctacctgaagcagatccgcctg
ggcttcgacctgtcctatatcgccagcaccctgctcaaccacgccaatatcgccaaggag
ctggtgcgtctgttcaagacccgcttctacctcgcgcgcaagctggcggcggacgacctg
gaagacaagcagcagaagctcgaacaggcgatcctcggtgagctggacaacgtcgccgtg
ctcaacgaagaccgcatcctgcggcgctacctggacctgatcaaggcgaccctgcggacc
aacttctaccagccggacgctgctggccagaacaagtcctacttcagcttcaagctgagc
ccgcgccagattccggatatcccgcggccggtgcccaagttcgagatcttcgtctactgc
ccgcgcgtggagggcgtgcacctgcgcttcggcgacgtggcccgtggcggcctgcgctgg
tccgatcgcgaggaagacttccgcaccgaagtgctggggctggtgaaggcgcagcaggtg
aagaacgcggtgatcgtgcccatgggcgccaagggcggcttcatcccccgtcgactgccg
gtgggtggcacccgcgacgatatccagaacgaggcgatcgcctgctaccgcatcttcatc
tccggcctcctggacgtcaccgacaacctaaaggaaggcaaggtggtaccgccggccaac
gtggtgcgccacgacgccgacgacccttacctcgtggtggcggccgacaagggcaccgcg
accttctccgacatcgccaacggcatcgcccaggactacggtttctggctgggcgacgcc
ttcgcttccggcggctcggcgggctacgaccacaagggcatgggcatcaccgccaagggc
ggctgggtgtcggtgcagcgtcacttccgcgagcgcggcatcgatgtgcagaaggatcac
gtcaccgtgatcggcatcggcgacatggccggcgatgtgttcggcaacggcctgctgctg
tcggacaagctgcagctggtggccgccttcaaccacatgcacatcttcatcgacccgaac
ccggacgccgcctccagcttcgtcgaacgcaagcgcctgttcgacctgccgcgctcctcc
tgggccgactacgacgccaagctgatctccgagggcggcggcatcttcctgcgcagcgcc
aagagcatcgccatcagcccgcagatgcagcagcgcttcgagatcgaagccgacaagctg
ccgcccaccgaactgctccacgcgctgctgaagtcgccggtggacctgctctggaacggc
ggtatcggcacctacgtcaaggccagcagcgaaagccatgccgacgtgggtgacaaggcc
aacgatgccctgcgcgtcgacggccgcgaactgcgtgccaaggtggtgggcgagggcggc
aacctcggcatgacccagctgggccgcgtcgagtacggcctcaatggcggcgccagcaac
accgacttcatcgacaacgccggcggcgtggactgctcggaccatgaggtcaacatcaag
atcctgctcaacgaaatcgtcggggccggcgacatgaccggcaagcagcgcaacaagctg
ctggccgagatgaccgacgacgtgggcaacctggtgctgggcaacaactacaagcagacc
caggcgttgtccctggcgcagcgtcgcgcccgggagaagatcggcgagtacaagcgcctg
atcaccgcactggaagcggccggcaagctggaccgtggcctggagttcctgcccaccgac
gatgagctgaacgagcgcatcgccgtcggccagggcctgacccgccccgagctggcggtg
ctgatctcctacagcaagatcgacctgaaggagtcgctgctcaagtcgctggttccggac
gacgactacctggcccaggaaatggaaaccgcgttcccggcgcgcctggccgagaccttc
ggcgagtccatgcgccgccatcgcctgaaacgcgagatcatcagtacccagatcgccaac
gacctggtcaaccacatgggcatcaccttcgtgcagcgcctgaaggagtccaccggcatg
agcgcggccaatgtggccggcgcctatgtggtggtgcgtgatgtcttccgcctgtcccac
tggtggcagcagatcgaggcgctggactacaaggtcccggccgaactgcagctgaccctg
atggacgagctgatgcgcctgggccgccgcgctacccgttggttcctgcgcagccgccgc
gaggaccagaacgccgcccgtgacgtcaaccacttcgccccgcgcgtggaggccctggcc
ggccgcctggacgagctgctcgaaggcccgtcccgcgagcagtggctggcacgcttccag
tcctatgtcgaagccggcgcccccgaagagctggcgcgggtggtggcgggcaccagccac
ttctacaccctgctgccgatcatcgaagcctcggacgtcaccggcaaggacacggccgat
gtcgccgccgcctacttcgccgtgggtggcgcgctggacctgtcctggtacctgcagcag
atcaccagcctgccggtggagaacaactggcaggccctggcgcgggaagccttccgcgac
gacctggactggcagcagcgggcgatcaccatttccgtcctgcagatgaacgaagggccg
gtggaaatcgaggagcgggtggcgctgtggctggatcagcaccgcgtgctggtagagcgc
tggaaggccatgctggtggagctgcgcgcggctaccaccaccgactacgccatgtacgcg
gtggccaaccgcgagctgatggacctggcgcaaagcggccagcacggggtgtgcatcctt
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system