KEGG   Pseudomonas resinovorans: PCA10_24580Help
Entry
PCA10_24580       CDS       T02708                                 

Definition
putative catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
pre  Pseudomonas resinovorans
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PCA10_24580
  Amino acid metabolism
   00380 Tryptophan metabolism
    PCA10_24580
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PCA10_24580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2699580..2700638)
Genome map
AA seq 352 aa AA seqDB search
MSKAPPKEIDLAARLALIGLAVGGLAAGFAYAAGWIGGERLTPQRIIDTFEANAGKFPGY
RKNHAKGICIAGHFESSGEAAGLSRASVFAPGTVPVIGRLAIGGSNPHAPDAGVPVRSMA
LLFQLPGGEQWRTAMNTPPVLPVATPEAFYEQVLAGRPDPATGKPDPAKMQAFFAAHPES
AAFRQWAQGAKPSNSFANIAYNGINAFRLVDAAGNARYVRWSVLPEAPFEPLGDAGTDPD
FLSHDLQQRLAQGPLRWRLVLTLAEPGDPTDDATRQWPAERRQVNAGTLVVESAEAQANG
ACRDINYDPLVLPDGIQASGDPILAARSAAYAVSYNRRTREGAPQPETGVRP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcaccacccaaggagatcgacctggcggcgcgactggcactgatcggcctg
gccgtcggcggcctggccgcaggcttcgcctatgccgccggctggatcggcggcgaacgc
ctgaccccgcaacgaatcatcgacaccttcgaagccaacgccggcaagttccccggctac
cgcaagaatcacgcaaagggcatctgcattgccgggcacttcgaaagcagcggcgaggct
gccgggctgtcccgcgccagtgtgttcgcccccggcacagtaccggtcataggccgcctg
gccatcggcggcagcaacccccacgcgccggatgccggcgtacccgtgcgcagcatggcg
ctgctcttccagctgccgggcggcgagcaatggcgcaccgccatgaacacaccgccggtg
ctgccggtagccaccccggaggccttctacgagcaggtgctggccggccgacccgacccg
gcaaccggcaagccggacccagcgaagatgcaggccttcttcgccgcccacccggaaagc
gcggccttccgccagtgggcccagggcgccaagcccagcaacagcttcgccaatatcgcc
tacaacggcatcaacgccttccgcctggtggacgccgccggcaacgcccggtacgtgcgc
tggtcggtgctgccggaggcgcccttcgagcccctgggagatgccggcacggacccggac
ttcctcagccatgacctgcagcagcgcctggcccaggggccgctgcgctggcgcctggtg
ctgaccctggccgaacccggcgaccccaccgacgacgccacccgccagtggccggccgaa
cgccgccaggtgaacgccggcaccctggtggtggaaagcgccgaagcccaggccaacggc
gcctgccgcgacatcaattacgacccgctggtgctgccggacggaatccaggcctcgggc
gacccgatcctcgcggcgcgctcggccgcctatgccgtgtcctacaaccgccgcacccgc
gaaggtgcgccccagcccgagacaggagtccggccatga

DBGET integrated database retrieval system