KEGG   Pseudomonas resinovorans: PCA10_53260Help
Entry
PCA10_53260       CDS       T02708                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
pre  Pseudomonas resinovorans
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pre00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pre00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pre00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pre00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:pre00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pre00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5917300..5918595
Genome map
AA seq 431 aa AA seqDB search
MVVENKQVDLLVVGGGAAGLSAALTAERRGLSCQVLEAQERLGGRLWSIRSDADAMWVDL
GGQLVNGDMSRVLRIARDAGLHLAPVAGTGAVKTVLADDRVYRDLARNSEGWMDMLLTPE
LVARAQAATSAPTLSEVLDWLNLDQQEAQLIRSTICEMFGHPAEALDGLGAILETQTFRS
QRSDIEFQFRRGFSGIIEQLASSLRQAPLLQTPVHAISRHGERIIARTDAGEWSAAHLVI
AVPPPVVRHIQLDLDDVDSHLTAALDSFVGGELIKFILTFDTPFWRYTGLSGQVEYLEPA
GLNLVDGSLDDGSHPRLVAFLGGPLARQWAGQSAGWRRQALLDLMAKAFGEQVYQVRSVH
EGNWVDHRWCAGAYNSHIRAGGMSDACEYLASWGKGIAFAGAEYAASYRGFVEGALDSGE
KAVLRLLDAAG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggagaacaagcaggtggacctgctggtggtggggggcggcgcggccggcttg
tcggcggcgctgacagccgagcgtcggggcctcagctgccaagtgctggaagcccaggag
cgcctgggcggacgactctggtcgatccgttccgacgcggacgccatgtgggtggacctg
ggaggccaactggtcaacggcgacatgagccgggtactgcgcatcgcccgggatgccggc
ctgcacctcgccccggtcgccggcaccggcgcggtgaagacggtactggccgatgaccgt
gtctaccgtgaccttgcgcgtaacagcgaaggctggatggacatgctgctgaccccggaa
ctggtggcgcgggcacaagccgccacatctgcgcccacactcagcgaggtgctggactgg
ctgaacctggaccagcaggaggcgcaactgatccgcagcaccatctgcgagatgttcggc
cacccggccgaggccctggacgggctgggcgccatcctcgaaacccagaccttccgctcc
cagcgcagcgatatcgaattccagttccgccgtggcttcagcggcatcatcgagcaactg
gccagcagcttgcgccaagcgccgctgctgcagacgccggtccacgccatcagccggcat
ggcgagcgcatcatcgcccgcaccgacgccggcgaatggtcggccgcccacctggtgatc
gcggtgccgccgccggtggtccggcatatccagctcgacctggacgacgtcgactcgcac
ctgacggccgccctggacagtttcgtcggcggtgaactgatcaagttcatcctcaccttc
gacacccccttctggcgctacaccggcctcagcggccaggtggaatacctggaacccgcc
ggcctgaacctggtggacggcagcctcgacgacggcagtcacccgcgcctggtggccttt
ctcggcggcccactggcccggcaatgggccgggcagtccgccggctggcgccgccaggcc
ctgctggacctgatggcgaaagccttcggcgagcaggtctaccaggtacgctcggtgcac
gaaggcaactgggtcgaccaccgctggtgcgccggcgcctacaactcccatatccgcgcc
ggcggcatgagcgacgcctgcgaatacctggccagctggggcaaaggcatcgccttcgcc
ggcgccgagtacgcagccagctacagaggctttgtggaaggcgcgctggacagtggggag
aaggcggttctgcggttgctggatgcggcaggctaa

DBGET integrated database retrieval system