KEGG   Pseudomonas resinovorans: PCA10_53260Help
Entry
PCA10_53260       CDS       T02708                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
pre  Pseudomonas resinovorans
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCA10_53260
   00330 Arginine and proline metabolism
    PCA10_53260
   00340 Histidine metabolism
    PCA10_53260
   00350 Tyrosine metabolism
    PCA10_53260
   00360 Phenylalanine metabolism
    PCA10_53260
   00380 Tryptophan metabolism
    PCA10_53260
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PCA10_53260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5917300..5918595
Genome map
AA seq 431 aa AA seqDB search
MVVENKQVDLLVVGGGAAGLSAALTAERRGLSCQVLEAQERLGGRLWSIRSDADAMWVDL
GGQLVNGDMSRVLRIARDAGLHLAPVAGTGAVKTVLADDRVYRDLARNSEGWMDMLLTPE
LVARAQAATSAPTLSEVLDWLNLDQQEAQLIRSTICEMFGHPAEALDGLGAILETQTFRS
QRSDIEFQFRRGFSGIIEQLASSLRQAPLLQTPVHAISRHGERIIARTDAGEWSAAHLVI
AVPPPVVRHIQLDLDDVDSHLTAALDSFVGGELIKFILTFDTPFWRYTGLSGQVEYLEPA
GLNLVDGSLDDGSHPRLVAFLGGPLARQWAGQSAGWRRQALLDLMAKAFGEQVYQVRSVH
EGNWVDHRWCAGAYNSHIRAGGMSDACEYLASWGKGIAFAGAEYAASYRGFVEGALDSGE
KAVLRLLDAAG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggagaacaagcaggtggacctgctggtggtggggggcggcgcggccggcttg
tcggcggcgctgacagccgagcgtcggggcctcagctgccaagtgctggaagcccaggag
cgcctgggcggacgactctggtcgatccgttccgacgcggacgccatgtgggtggacctg
ggaggccaactggtcaacggcgacatgagccgggtactgcgcatcgcccgggatgccggc
ctgcacctcgccccggtcgccggcaccggcgcggtgaagacggtactggccgatgaccgt
gtctaccgtgaccttgcgcgtaacagcgaaggctggatggacatgctgctgaccccggaa
ctggtggcgcgggcacaagccgccacatctgcgcccacactcagcgaggtgctggactgg
ctgaacctggaccagcaggaggcgcaactgatccgcagcaccatctgcgagatgttcggc
cacccggccgaggccctggacgggctgggcgccatcctcgaaacccagaccttccgctcc
cagcgcagcgatatcgaattccagttccgccgtggcttcagcggcatcatcgagcaactg
gccagcagcttgcgccaagcgccgctgctgcagacgccggtccacgccatcagccggcat
ggcgagcgcatcatcgcccgcaccgacgccggcgaatggtcggccgcccacctggtgatc
gcggtgccgccgccggtggtccggcatatccagctcgacctggacgacgtcgactcgcac
ctgacggccgccctggacagtttcgtcggcggtgaactgatcaagttcatcctcaccttc
gacacccccttctggcgctacaccggcctcagcggccaggtggaatacctggaacccgcc
ggcctgaacctggtggacggcagcctcgacgacggcagtcacccgcgcctggtggccttt
ctcggcggcccactggcccggcaatgggccgggcagtccgccggctggcgccgccaggcc
ctgctggacctgatggcgaaagccttcggcgagcaggtctaccaggtacgctcggtgcac
gaaggcaactgggtcgaccaccgctggtgcgccggcgcctacaactcccatatccgcgcc
ggcggcatgagcgacgcctgcgaatacctggccagctggggcaaaggcatcgccttcgcc
ggcgccgagtacgcagccagctacagaggctttgtggaaggcgcgctggacagtggggag
aaggcggttctgcggttgctggatgcggcaggctaa

DBGET integrated database retrieval system