KEGG   Pseudomonas resinovorans: PCA10_p0380Help
Entry
PCA10_p0380       CDS       T02708                                 

Gene name
carF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pre  Pseudomonas resinovorans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PCA10_p0380 (carF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCA10_p0380 (carF)
   00650 Butanoate metabolism
    PCA10_p0380 (carF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    PCA10_p0380 (carF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PCA10_p0380 (carF)
   00622 Xylene degradation
    PCA10_p0380 (carF)
   00621 Dioxin degradation
    PCA10_p0380 (carF)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PCA10_p0380 (carF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCAR1.3:35797..36744
Genome map
AA seq 315 aa AA seqDB search
MADTGRAKVAIIGSGNIGTDLMIKILRHGKFLEMGALVGIDPASDGLERAKRMGVATTAG
GIEGLLEMPGFSDIRIAFDATSAGAHHRHNKLLQEKGVRVIDLTPAAIGPYVIPAINLDE
QLSAKNINMVTCGGQATIPIVAAISKVAKVHYAEIVASISSKSAGPGTRANIDEFTETTS
RAIEVLGGASKGKAIIVLNPAEPPLIMRDTVFALSDIANKSAVEDSILEMVERVNSYVPG
YRLKQKVQFDIFDEKNALNLPGIGRKAGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAAMA
CAERMAQTQLVEETA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatacaggcagagcaaaggtagcaattatcgggtcgggtaacatcggtactgac
ctcatgattaagatcctgcgtcatggaaagtttttagaaatgggcgcgttggtgggcatc
gatcctgcttcagatggcttagagcgcgcaaagcgcatgggtgtagcaacaacagctggc
ggtatcgagggacttcttgagatgccaggattttctgatatacgcattgcctttgatgca
acgtctgctggcgcgcatcaccgacacaacaaattgctacaggaaaaaggtgtgcgcgtt
attgatttaacgccggccgcaattggtccttatgttattccagctattaatttagacgag
caattgtccgctaagaatatcaacatggtgacctgcggtgggcaagctactattccaatt
gtggcggcgatttctaaagttgcgaaagtacattacgcggagatcgttgcatctatttct
agtaaatctgcgggacctggaacgcgcgcaaacattgacgagttcactgaaactacttcg
cgggcgattgaagttcttggcggagcatcgaaaggaaaggcgattattgtactgaatcct
gcagaaccgcctctgattatgcgtgacacagtctttgcattgtctgacattgctaataaa
tcggccgttgaggacagtattctggaaatggtggagagggtgaactcttatgtcccaggg
tatcgtttgaaacaaaaagtccagttcgatatctttgacgagaaaaatgcacttaaccta
ccaggtattggcagaaaagcaggcttaaagacctctgtgttcttggaggttgagggcgcg
gcgcattacctaccagcatacgctggtaacctcgatattatgacctcggccgcgatggcc
tgtgctgagcgcatggctcaaacacaattggttgaagaaacggcgtga

DBGET integrated database retrieval system