KEGG   Paenibacillus riograndensis: PRIO_0486Help
Entry
PRIO_0486         CDS       T03849                                 

Gene name
phaA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pri  Paenibacillus riograndensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pri00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PRIO_0486 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    PRIO_0486 (phaA)
   00640 Propanoate metabolism
    PRIO_0486 (phaA)
   00650 Butanoate metabolism
    PRIO_0486 (phaA)
  Lipid metabolism
   00071 Fatty acid degradation
    PRIO_0486 (phaA)
   00072 Synthesis and degradation of ketone bodies
    PRIO_0486 (phaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PRIO_0486 (phaA)
   00310 Lysine degradation
    PRIO_0486 (phaA)
   00380 Tryptophan metabolism
    PRIO_0486 (phaA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PRIO_0486 (phaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PRIO_0486 (phaA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PRIO_0486 (phaA)
Enzymes [BR:pri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PRIO_0486 (phaA)
Exosome [BR:pri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PRIO_0486 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(532224..533309)
Genome map
AA seq 361 aa AA seqDB search
MTACLQQSRLEPALIDQIYLGNVLQAGIGQNPARQAALKAGIPIDVPASTINTVCGSGLH
AVALAYNSILAEQGSVLLAGGMESMSNAPYVLKNARNGYKLGNGELIDSVVADGLTCPIN
KYHMGITAENIAAKYNISRLEQDEFAYGSQIKAREAKNKQVFAEQIVPVLTKTKKAEIWF
SEDEHVRADTSKEKLSNLKPVFKENGSVTAGNASGINDGAAAVLVMSEDKCKEHAVQPLA
YIKGYSLVGVDPAYMGMGPVKAISSLLREQGIPLEAIDLFEINEAFAAQALAVLKELGIN
PEKVNVNGGAIAIGHPVGASGARILVTLVHEMVRRSSRYGIASLCIGTGMGIAMLVENAL
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacggcatgccttcagcaaagccgcttagagcctgcattgattgatcaaatttattta
ggaaatgtccttcaagcgggcattggccaaaatcctgccagacaggcggccctaaaagcc
ggcatccctattgatgtacctgcatcaacaataaacacggtttgcggttcagggcttcat
gccgtcgctttagcttacaactctattttggcagaacaaggcagcgtcctactggctgga
ggtatggagagcatgtcgaacgccccttatgtgctaaagaatgcacgaaatggctacaag
cttggcaacggtgaattgatagacagcgtggtagccgacggccttacatgtcccatcaat
aaatatcatatgggaattaccgcagaaaacattgccgcgaaatataacatttcaagactt
gagcaggatgagtttgcctatggaagccagatcaaggccagggaagccaaaaacaagcag
gtttttgcagagcagattgttcccgttttgaccaaaaccaaaaaagcagagatttggttc
tcggaagacgaacatgtaagagcagatacaagcaaagaaaaactttctaatctaaaacct
gtatttaaggaaaacggatcagttactgccggaaatgcctcggggatcaatgatggggcg
gcggctgtacttgttatgtcggaagacaaatgcaaggagcatgcggtacaaccgttggcc
tatatcaagggttattcccttgtcggcgttgaccctgcatatatggggatgggtccggtg
aaggccatttcgtcactgcttagggaacagggaattcctcttgaggccatcgatctgttt
gagattaatgaagccttcgctgcacaagcattagcggtattgaaagagctggggatcaac
ccggagaaggtgaatgtcaacggcggcgcaatcgcgattggacatcctgtcggtgcaagc
ggagccagaatattggttacgctcgtgcatgaaatggtacggagatcttcacgttacggc
atagcctcattatgcattggaacgggtatgggaatcgcgatgctggttgagaatgcactc
atctaa

DBGET integrated database retrieval system