KEGG   Paenibacillus riograndensis: PRIO_1095Help
Entry
PRIO_1095         CDS       T03849                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pri  Paenibacillus riograndensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pri00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PRIO_1095 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    PRIO_1095 (thlA)
   00640 Propanoate metabolism
    PRIO_1095 (thlA)
   00650 Butanoate metabolism
    PRIO_1095 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    PRIO_1095 (thlA)
   00072 Synthesis and degradation of ketone bodies
    PRIO_1095 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PRIO_1095 (thlA)
   00310 Lysine degradation
    PRIO_1095 (thlA)
   00380 Tryptophan metabolism
    PRIO_1095 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PRIO_1095 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PRIO_1095 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PRIO_1095 (thlA)
Enzymes [BR:pri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PRIO_1095 (thlA)
Exosome [BR:pri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PRIO_1095 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1237748..1238932
Genome map
AA seq 394 aa AA seqDB search
MKEVVIVSAVRTAVGSFGGVFKNVPAVTLGTVAVKGALAKINLDPAEVDEVILGNVLQAG
LGQNVARQISIQAGIPMEVPSYTINKVCGSGLKSVQLAAQTILAGQAEVVVAGGAENMSQ
APYLLPTTRWGQRMGDGIVIDSMVHDGLTDAFNQYHMGITAENIAEKYNITREMQDKLAA
ASQNKAEKAIKEGKFKEEIIPVEIPQRKGAPVVANTDEYPRMGVTAESLAELKPAFKKDG
TVTAANASGLNDGAAILIVMSKSKAERLGLKPLVTIKAVECAGVAPEIMGTGPIPATKKA
LATAGITVQDLDLVEANEAFASQALCVVNELGINMDMVNVNGGAIALGHPIGASGARILV
TLIHEMERRKVQTGLATLCIGGGQGIAMIVEREG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagttgttattgtgtcagcggtgagaaccgcagtgggctcttttgggggagtt
tttaaaaatgtaccggctgttaccttaggaacagttgctgtaaagggagcattggcaaaa
attaatttagaccctgcagaagttgatgaagttattttaggtaatgttttacaggccggg
ttagggcaaaatgtcgcaaggcagatatctatacaagccgggattccaatggaagtgccg
tcatataccatcaataaagtttgcggttcaggcttaaagtccgttcagcttgcggctcag
acaatcctggccggccaggcggaggttgtagttgcaggcggagcagagaatatgagccag
gcgccttatctgctgccgacaacccggtggggacaaagaatgggtgacggaatcgttata
gattcgatggttcatgatggattaacggatgcttttaatcaatatcatatgggaattact
gctgaaaatatcgctgaaaaatacaatattacgagagaaatgcaagataaattagcggca
gcaagccaaaataaagcagagaaagccatcaaagaagggaaattcaaagaggagattatt
cctgttgagattccgcagcggaaaggcgcgccagtggtagcgaacaccgatgagtaccct
cgaatgggagtgaccgcagaaagcctggctgaattaaaaccggcttttaaaaaggacggc
acagtaacagcagccaatgcttcaggcctgaatgacggtgcggcaatattgattgtgatg
agcaaaagtaaagctgaacgtttaggcttaaaaccgcttgtaacgattaaagctgttgaa
tgtgcaggggttgccccggaaattatgggtacaggacccattccggcaacaaaaaaagcc
ttggcgacagccggtataacggtgcaggatttggatctagttgaagcgaatgaagccttt
gcgtcacaagcattatgtgtcgtaaatgaattaggaataaacatggatatggtcaatgta
aacggcggagccattgctttggggcatcccattggcgccagcggtgcacgcatattggta
acactgattcatgaaatggaaagaagaaaggttcaaactggtttggcaactctatgtatc
ggcggtgggcaaggcattgccatgattgtagagagagaggggtaa

DBGET integrated database retrieval system