KEGG   Prevotella sp. oral taxon 299: HMPREF0669_01043Help
Entry
HMPREF0669_01043  CDS       T02809                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pro  Prevotella sp. oral taxon 299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0669_01043
Enzymes [BR:pro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF0669_01043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:1537482..1540187
Genome map
AA seq 901 aa AA seqDB search
MKASNITFNIQYSTTYGEELLLNLIYFDKEGIERTSIYRMKTLDGHNWRVHIQQLPSDGI
KAFHYYYSIERNAEIIKSEWQLQTHFFDFNATCDKNYEVFDIWTDAPQDTYLYSSAFTNC
INQREIKTLEPNDYAITLRLVVHAPQLRSFERLAVVGDLDVLGAWNINKALFMTEQQHNE
WVIDINASSFVGEKIEFKFVAINKQNQSFSLWETENNRSLSIPLVNKGNTLVYSLNQAFF
DICDIRLAGTLIPLFSLRTNNSFGIGDFGDLKRMIDFMSCTNQRVLQLLPINDTTSSGTW
KDSYPYSCVSVFALHPQYINLNALPSLRDKEQHLRFQKLQKELNSLEHVDYERVNCAKNE
YLSLLYKQEGTKILGSKEFSVFFENNQEWLVPYALYCSLRDKYKTPLCSNWGEYREWNDS
WRTTLSNPKSKEYKAVAYYYFVQYLLFSQMKDAHAYALSKQVILKGDIPIGVDRHSCDVW
VEPKYFNLNSQAGAPPDAFSTNGQNWGFPTYNWNEMLKDNCAWWTKRFQHMSQFFDAYRI
DHVLGFFRIWSIPYDSIHGLLGQFEPAIALSKDEIEAYGLHFQEKLFTTPFIADWVIERV
FKEHSEEVKQTYLELDHDDIYRLKPNFDTQRKIAEAFEGKHSEKDNWLREGLFALVSNVL
FIRDNHNPHLFHPRITAQLNHMYEALWQHDKDSFNRLYDDYYYKRNNHYWYCEAMKKLPR
LVQATKMLVCAEDLGMIPSCVEWVMKELRIFSLEIQSMPKDPHVRFGYLNRNPYQSVSTI
STHDMPTLRLWWDENNEQTQDYYNNMLYHSGCAPHPLTGQLAQEIIEGHLHSPSALCVIS
LQDWLAMDEKIRLSDPQSERINIPANPNHYWRYRMHISIEDLIANHELVNRITGMLRTSG
R
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatcaaatatcacattcaatattcaatatagcactacttatggtgaggagttg
cttttgaatcttatttattttgataaggagggaatagaacggacatctatttatagaatg
aaaacattggacgggcataattggagggttcatattcaacaacttccatccgatggtatc
aaagcatttcactattattatagcattgaaagaaatgcagagataataaaatcagaatgg
caactacaaactcatttcttcgattttaatgcaacttgtgataagaactatgaggttttt
gatatttggacagatgcacctcaggatacatatttatatagttctgcttttacaaactgt
ataaatcaacgagaaataaaaactcttgaacctaatgattatgctattacgcttcgttta
gtagtgcatgctcctcaattaaggtcatttgaacgtcttgcagttgtaggtgatttagat
gtattaggagcatggaatatcaataaagcgttgtttatgacagaacaacagcataacgaa
tgggttattgatattaacgcatcgtcgtttgttggggagaaaattgagtttaaatttgtt
gctataaataaacaaaatcagagtttctcattatgggaaacagaaaataatcgctccctt
tcaatccctcttgtcaacaaaggcaatacacttgtatactcattaaatcaagcattcttt
gatatttgtgatattcgtttagctggaaccttgattcctttgttctcattgcgcactaat
aacagctttggaattggcgactttggcgacttaaaacgcatgattgatttcatgtcgtgc
accaatcaacgagtacttcaattgttgccaatcaacgatactacatcttctggaacatgg
aaagatagctatccctatagttgtgttagtgtttttgctcttcatccacaatatatcaat
ctaaatgcattaccttctttaagagataaagaacaacatttgcgtttccaaaagctgcaa
aaagaacttaatagtctagagcatgttgattatgagagggtgaattgtgctaagaatgaa
tatctatcacttctttataaacaagagggaaccaaaatattaggatcaaaagaattctca
gttttctttgaaaataatcaagaatggcttgtaccttatgccttatattgttctttacga
gataagtataagacacctttatgtagtaattggggcgaatatcgagagtggaacgatagt
tggcgtacgacattatcaaatcctaaaagcaaggagtataaggcggttgcttactattac
tttgttcaatatcttttattctcacaaatgaaagatgcgcatgcttatgctcttagcaag
caagtgatattgaaaggagacattcctattggtgtagaccgacatagttgcgacgtttgg
gtagaaccaaagtattttaatctcaactcacaagcaggtgcaccacctgatgctttctct
acaaatggccagaattggggcttccctacgtataattggaacgagatgttgaaagacaat
tgtgcgtggtggacaaagcgttttcaacacatgtcgcagttttttgatgcctatcgcatc
gatcatgtcttaggtttctttagaatttggagtattccctatgattcaattcatggactt
ttaggacagtttgaacctgctattgccttatcaaaagacgaaatagaagcttatggtttg
cattttcaagaaaagttattcaccactccttttattgcagattgggtaattgagcgtgtc
tttaaggagcattctgaagaagtaaaacaaacgtatttggaattagatcatgatgatata
tatcgtttaaagcctaatttcgatacacaaagaaagattgctgaggcctttgaaggaaaa
cattctgaaaaagataattggttgcgtgaaggattatttgcgctagtaagtaatgttctt
tttatcagagataatcacaatcctcatctcttccatccacggataacagcccaattgaat
catatgtatgaggctttatggcaacacgataaagattctttcaatcgtttgtatgatgat
tattattacaaacgaaacaatcactattggtattgtgaagcaatgaagaaattaccaagg
ttagttcaagctacaaagatgctagtttgtgcagaagatttaggtatgattccttcttgt
gtagagtgggttatgaaagaattacgcatctttagtcttgagatccaatcaatgccaaaa
gatcctcatgtgagatttggatatctaaatcgcaatccttatcagagtgtttcaactatt
agtacccacgatatgccaactcttcgtttatggtgggatgaaaacaatgaacaaacgcaa
gattattataataatatgctttatcattcgggttgcgcacctcatccacttacagggcaa
ttagctcaagaaattatcgaaggtcatttgcattcaccttctgcattgtgtgttattagc
ttgcaagactggcttgctatggatgaaaagataaggttgtctgatcctcaaagtgaaaga
attaatattccagctaaccccaatcattattggagatatcgaatgcatatcagtattgaa
gaccttattgcgaatcacgaattggtgaatcgtattacaggaatgcttcgtacaagtggt
cgatag

DBGET integrated database retrieval system