KEGG   Prevotella sp. oral taxon 299: HMPREF0669_01735Help
Entry
HMPREF0669_01735  CDS       T02809                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pro  Prevotella sp. oral taxon 299
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0669_01735
Enzymes [BR:pro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HMPREF0669_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284118..285509
Genome map
AA seq 463 aa AA seqDB search
MNIERKEYTKDIVVIGAGITGLTTAYWLKKGGKDVEVLEKEERFGGQIHTFHVDGYLFES
GPNTGVLSSPEAVELFNSIAADCQVDIARSSAKRRLVWKKDSFTVLPTSLSTAITTPLFT
TYDKLRILGEPFRAKGSDPNESVADMVKRRLGKSYYNYAVDPFIAGIYAGDPTKLITRYA
LPKLYQLEQNYGSFIRGAIKKAKEKKTERERLATKDVFSPSHGMEQIIKALAKNIGEKNI
VLGANNLSVAPQEDGSYSVTYTNSQGNECVVRANKVITTCGAYALPQVLPFVTEKEKQAL
SNLTYAPVVQVGVGIKYVNNRTLNAFGGLVPTIERQKLLGVLFTSACFDNRAPQNSTTLS
FFLGGMKDQDMVNKSDEEIVSLVKDAIHRMLKVPNDIEIEAIKISRHQRAIPQYWANTEE
RIKAVQAVEQRYKGLIVAGNLRDGIGVADRIKQGTLVAQSILG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagaacgaaaagaatatacgaaagatattgttgtgattggggctggcataaca
ggcttaaccactgcttattggttgaaaaaaggaggaaaagacgttgaggtgcttgagaaa
gaagagcgttttggcggtcaaattcatacctttcacgttgatggttacttgttcgaaagc
ggaccaaatacaggtgttttatcatctccagaggcggtagaactgttcaatagcattgca
gccgattgccaagtggatattgctcgcagttcggctaaacgcagattggtttggaaaaaa
gacagctttacagtccttcccacctctctttcaactgcaataacaacgcccttgtttaca
acttacgacaagttgcgtatcttaggagagcctttcagagcaaaaggcagtgatcctaac
gagtcagtagccgacatggtgaagagaagactgggcaaatcgtattataattacgccgta
gatccattcattgcaggcatctatgcaggcgatcccacaaagctcatcactcgctatgcc
ttaccaaagctctatcaattagagcaaaactatggtagttttatacgtggagcgatcaag
aaagccaaagagaaaaagactgaaagagagcgtcttgccactaaagatgtattttctccc
agtcacggaatggagcaaattattaaggctttagccaagaatattggtgaaaaaaatatt
gttcttggagccaataatcttagtgttgcgccccaagaggatggctcttattcagtgacc
tataccaattcgcaaggcaatgagtgtgtggttagagctaataaggtcattacaacttgt
ggagcttacgcccttccgcaagtccttccctttgtaactgagaaagaaaagcaggcactt
agtaatttaacttatgcgccagtggttcaggtgggcgttggaattaagtatgtaaacaac
cgcacattgaatgcatttggaggcttagtgcccactattgaacggcaaaagctactcgga
gtgttgtttacttcggcttgtttcgataaccgtgcgccccaaaatagcaccacgttgtcg
tttttcttgggtggaatgaaagatcaagatatggtgaataaaagcgatgaagagattgtt
tcgcttgtgaaagacgctattcatcgtatgctaaaagtgcccaatgacattgaaatagag
gcgataaagatttcgagacatcaacgagcaatacctcaatattgggcaaatacagaagaa
agaataaaggctgtgcaagctgttgaacaacgatataaaggcttaattgtggctggaaac
cttcgagatggtatcggagtagctgacagaattaagcaaggaacgttggttgcacaaagt
attttagggtga

DBGET integrated database retrieval system