KEGG   Pseudomonas aeruginosa RP73: M062_01100Help
Entry
M062_01100        CDS       T02711                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M062_01100
Enzymes [BR:prp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     M062_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(248069..248851)
Genome map
AA seq 260 aa AA seqDB search
MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEAGHDSGLAGQITSRGP
EAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRFHSWVYRARPDVNCIIH
THPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGNEEGEIISAALGDKRAIL
LSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPIPPALAREAHDWISTPKRH
GAAFNYYARRCLPRNSDCLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctacgacactggaattacccaaggatcaactgatccagcacgcgctgaagcagatg
aaaagcagcctcggcgataatacgtggactgaccggcaaaagctggccctgacctgccgg
attctcttcgaggccggccacgactccgggctcgccgggcagatcacctcgcgcggcccg
gaggcggggacctactacacccagcaactgggcctgggcttcgacgagatcagcgccggc
aacctgctgctggtcgacgaagacctcaacgtcctccacgggcacggcatggcgaatccg
gccaatcgcttccacagctgggtctatcgcgcccgcccggacgtcaactgcatcatccac
acccacccgctgcacatcgccgcgctgtcgaccctggaagtaccgctgcaggtctcgcac
atggacctttgcccgctatacgacgactgcgccttcctcaaggactggccgggcgtgccg
gtaggcaacgaggaaggcgagatcatctccgccgccctcggcgacaagcgcgccatcctg
ctctcccaccacggcctgctggccaccggtgcgagcatcgaggaggcctgcgtgatcgcg
gtgctgctcgagcgcgcggcgaagatgcagttgctggcgatggccgccggggagatcaag
ccgatcccgccggccctggcgcgcgaggcccacgactggatctccaccccgaagcgccac
ggcgccgcattcaactactacgcccggcgctgcctgccgcgcaacagcgactgcctgagc
tga

DBGET integrated database retrieval system