KEGG   Pseudomonas aeruginosa RP73: M062_01310Help
Entry
M062_01310        CDS       T02711                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    M062_01310
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M062_01310
   00310 Lysine degradation
    M062_01310
Enzymes [BR:prp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M062_01310
    2.6.1.48  5-aminovalerate transaminase
     M062_01310
Amino acid related enzymes [BR:prp01007]
 Aminotransferase (transaminase)
  Class III
   M062_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295075..296355
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIEL
FEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgctgaagcgtcgccaggccgcggtaccccgcggcgtg
ggccagatccacccggtcgtcgccgagcgcgccgagaactccaccgtctgggacgtggaa
ggccgcgagtacatcgacttcgccggcggcatcgccgtgctgaacaccggccacctgcat
ccgaaggtgatcgccgcggtccaggagcaactgggcaagctgtcccacacctgcttccag
gtgctggcctacgaaccctacatcgagctggccgaggaaatcgccaagcgcgtgccgggc
gacttcccgaagaagaccctgctggtcacctccggctccgaagccgtggagaacgccgtc
aagatcgcccgcgccgccaccggccgcgctggcgtgatcgccttcaccggcgcgtaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggtggtcccgtactccgccggcatg
ggcctgatgccgggcggcatcttccgcgccctggcgccctgcgagctgcacggcgtgagc
gaggacgactccatcgccagcatcgagcgcatcttcaagaacgatgcccagccccaggac
atcgccgcgatcattatcgagccggtgcagggcgagggtggcttctacgtcaactccaag
tccttcatgcagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtgcagaccggcgccggccgtaccggcaccttcttcgctaccgagcaactgggcatc
gttcctgacctgaccaccttcgccaagtcggtcggcggcggcttcccgatctccggcgtg
gccggcaaggccgagatcatggacgccatcgcgcccggcggcctgggcggcacctatgcc
ggcagcccgatcgcctgcgccgcggcactggccgtgctgaaggtgttcgaggaagagaag
ctgttggaacgttcgcaagccgtcggcgagcgcctcaaggccggcctgcgcgagatccag
gccaagcacaaggtgatcggcgacgttcgtggcctgggttcgatggtggccatcgagctg
ttcgagggcggcgatacccacaagccggccgccgagctggtcagcaagatcgtcgtccgt
gcgcgcgagaagggcctgatcctgctctcctgcggcacctactacaacgtcatccgcttc
ctcatgcccgtcaccatccccgacgcgcaactggagaagggcctggccatcctggccgag
tgcttcgacgaactcgcttaa

DBGET integrated database retrieval system