KEGG   Pseudomonas aeruginosa RP73: M062_08460Help
Entry
M062_08460        CDS       T02711                                 

Definition
2-oxoglutarate dehydrogenase E1
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M062_08460
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M062_08460
  Amino acid metabolism
   00310 Lysine degradation
    M062_08460
   00380 Tryptophan metabolism
    M062_08460
Enzymes [BR:prp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     M062_08460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1783277..1786108
Genome map
AA seq 943 aa AA seqDB search
MHESVMQRMWNSAHLSGGNAAYVEELYELYLHDPNAVPEEWRTYFQKLPADGNPAPDVSH
STVRDHFVLLAKNQRRAQPVSAGSVSSEHEKKQVEVLRLIHAYRLRGHQASTLDPLGLWQ
RPAPADLSIDHYGLTGADLDTTFRTGELYIGKEEATLREIVDSLKSTYCGTFGAEFMHIV
DSEQRKWFLQRLESVRGRPGFSAEARAHLLERLTAAEGLEKYLGTKYPGTKRFGLEGGES
LIPMVDEIIQRCGSYGAKEIVIGMAHRGRLNVLVNTLGKNPRDLFDEFEGKKIVELGSGD
VKYHQGFSSNVMTSGGEVHLALAFNPSHLEIVSPVVEGSVRARQDRRKDSSGDKVVPISI
HGDAAFAGQGVVMETFQMSQTRAYKTGGTIHLVINNQVGFTTSRQDDARSTEYATDVAKM
IQAPIFHVNGDDPEAVLFVTQLAVDYRMQFKRDVVIDLVCYRRRGHNEADEPSGTQPLMY
QQIAKQRTTRELYADALVNAGVLSAEQVQSKIDDYRDALDNGLHVVKSLVKEPNKELFVD
WRPYLGHAWTARHDTRFDLKTLQELSSKMLEVPEGFVVQRQVSKIYEDRQKMAAGGLPIN
WGFAETLAYATLLFEGHPVRMTGQDVGRGTFSHRHAVLHNQKDDSVYVPLANLFDGQPRL
DIYDSFLSEEAVLAFEYGFATTTPNSLVIWEAQFGDFANGAQVVIDQFITSGESKWGRLC
GLTMLLPHGYEGQGPEHSSARLERYLQLCAEQNIQVCVPTTPAQVYHMLRRQVIRPLRKP
LVVMTPKSLLRHKLAISTLEDLANGSFQTVIPEIDSLDPKKVDRVVLCSGKVYYDLLEKR
RAEGREDTAIVRIEQLYPFPEDDLAEVLAPYKNLKHIVWCQEEPMNQGAWFCSQHHMRRV
IAAHKKGLNLEYAGREGSAAPACGYASMHAEQQEKLLQDAFTV
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaaagcgtaatgcagcggatgtggaacagtgcccatctatccggtggtaacgct
gcctacgtcgaagagctctacgagctctacctgcacgaccctaacgctgtgccagaagag
tggcgcacgtatttccagaagcttcccgccgatggcaatcccgcccccgacgtctcgcac
tccacagtgcgcgatcatttcgtcctgctggccaagaaccagcgccgtgcccagccggtt
tccgccggtagcgtgagcagcgagcacgagaagaagcaggtcgaagtccttcgtctcatt
cacgcttaccgtctccgcggccaccaggcttccaccctcgacccgctcggcctgtggcag
cgtcccgcgcctgccgacctgtcgatcgaccactacggtctgacgggtgccgacctggac
accactttccgcaccggtgagctttacatcggcaaggaagaggcgaccctgcgtgaaatc
gtcgacagcctgaagagcacctactgcggtaccttcggcgccgagttcatgcacatcgtc
gattccgagcagcgcaagtggttcctccagcgtctggaaagcgtgcgtggccgtcccggc
ttctccgccgaggcgcgtgcgcacctgctcgagcgcctgaccgcggccgaaggcctggag
aagtacctgggcaccaagtacccgggcaccaagcgtttcggcctggaaggcggcgaaagc
ctgatcccgatggtcgacgagatcatccagcgctgcggttcctacggcgccaaggaaatc
gtcatcggcatggctcaccgcggtcgcctgaacgtcctggtcaacaccctgggcaagaac
ccgcgcgacctgttcgacgagttcgaaggcaagaagatcgtcgagctgggctccggtgac
gtgaagtaccaccagggcttctcctcgaacgtgatgaccagcggtggcgaagtccacctg
gcgctggcgttcaacccgtcgcacctggaaatcgtttccccggtggtcgagggttccgtt
cgtgctcgccaggaccgccgcaaggacagctccggcgacaaggtggtaccgatttccatc
cacggcgatgccgccttcgcggggcagggcgtggtcatggaaaccttccagatgtcgcag
acccgcgcctacaagaccggtggcaccatccacctggtgatcaacaaccaggtcggtttc
accaccagccgccaggacgatgcgcgttccaccgagtacgccaccgacgtggcgaagatg
attcaggcgccgatcttccacgtcaacggcgacgatcccgaagccgtgctgttcgtcacc
cagctggccgtcgactaccgcatgcagttcaagcgtgacgtggtcatcgacctggtctgc
taccgtcgccgcggccacaacgaggcggacgagccgagcggcacccagccgctgatgtac
cagcagatcgccaagcagcgtactacccgcgagctgtacgccgatgccctggtgaatgcc
ggcgtgctcagcgccgagcaggttcagtcgaagatcgacgactaccgcgacgccctggac
aacggcctgcacgtggtgaagagcctggtcaaggaacccaacaaggaactgttcgtcgac
tggcgtccgtacctgggtcatgcctggaccgcgcgtcacgacacccgcttcgacctgaag
accctgcaggaactgtccagcaagatgctggaagtgccggaaggcttcgtggttcagcgc
caggtttcgaagatctacgaagatcgccagaagatggcggccggtggcctgccgatcaac
tggggcttcgccgagaccctggcctacgcgaccctgctgttcgaaggccatccggtacgg
atgaccggccaggacgtcggccgtggcaccttctcgcaccgtcacgcggtgctgcacaac
cagaaggatgactcggtctacgtaccgctggccaatctgttcgacggccagccgcgcctg
gatatctacgattccttcctttcggaagaggccgtgctggcgttcgaatacggtttcgcc
accaccacgccgaactcgctggtgatctgggaagcccagttcggcgacttcgccaacggc
gcccaggtggttatcgaccagttcatcaccagtggcgaaagcaaatggggccgactctgc
ggcctgaccatgctgctgccgcacggctatgaggggcagggcccggagcactcctccgcg
cgcctggagcgctacctgcagctctgtgccgagcagaacatccaggtctgcgtgccgacc
accccggctcaggtctaccacatgctccgccgtcaggtgatccgcccgctgcgcaagccg
ctggtggtgatgacgccgaagtccctgctgcgtcacaagctcgccatctcgaccctggaa
gatctggccaacggttccttccagaccgtgatcccggaaatcgacagcctggatccgaag
aaggtcgaccgcgtcgtgctgtgcagcggcaaggtgtactacgacctgctggagaagcgt
cgcgcggaaggccgcgaagataccgcgatcgtccgtatcgagcagctgtatccgttcccg
gaagacgacctggcggaagttctggctccgtacaagaacctcaagcacatcgtctggtgc
caggaagagccgatgaaccagggcgcctggttctgcagccagcatcacatgcgtcgtgtc
atcgccgcgcacaagaagggcctcaacctcgagtacgccggccgcgaaggctccgctgct
ccggcttgcggctacgcctcgatgcacgccgagcagcaggaaaaactgctgcaagacgcc
tttactgtttaa

DBGET integrated database retrieval system