KEGG   Pseudomonas aeruginosa RP73: M062_11215Help
Entry
M062_11215        CDS       T02711                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M062_11215
Enzymes [BR:prp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     M062_11215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2401078..2403132)
Genome map
AA seq 684 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDANGRPQRVDPEVQRGLLEALGYPAQSPQQIEQSLAALAR
LREDSANLGLLVGECGQPLEQALGPAGTPGELVYEDGTRIALRLDAEGRLPAQARSGYAR
LSLEQREWAVAMAPPSCPSLASLAPGRSRRWGLAAQVYALRRPGDGGLGDSAALEDLLRR
AARHGADALAISPLHALAEANGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIRRAG
LAAEMARLESLELIDWTAAADLRMRLLRQLHRDFTERASPLRHDLAEFRREAGEALLHHC
RFETLQAHLGAGPDWRRWPEPLRRPGEPAVAAFCADHAEEVDFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGADGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLRANLAWPGGLRIDHVMGLQRLWLIPRGQPPHAGAYLRYPQRELLR
LLALEASRASALVIGEDLGTVPEGLREELARRQVLGTRVLLFERRGERFVPPAQWPADAM
ATTSTHDLPSLSGWWRGQDIHWRGRAGHRSAEECAADLELRAEERRALAASLEPPVDPDP
AAEVPLDACIGYVGATPAPLVLLPLEDALGSLEQPNLPGPGDAHPNWRRRWPENAAQMLG
TPQVDRRLRLLERSRRGAEEAAHD
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gacgccaacggacggccgcagcgggtcgacccggaggtccagcgcggcctgctggaagca
ctcggctatccggcgcagagtccgcaacagatcgaacagagcctggccgcgctggcccgg
ctgcgcgaggacagcgccaacctcggactgctggtcggcgaatgcggccagccgctggag
caagcgctcggccccgccggcaccccgggcgagctggtctacgaggacggcacgcggatc
gccctgcgcctggacgccgaaggccgcctgccggcgcaggcccgcagtggctatgcgcgg
ctgtcgttggagcagcgggaatgggcggtggcgatggcgccgccgagctgtccgtccctg
gccagcctcgccccgggtcgctcgcgtcgctggggtctggccgcccaggtctatgccctg
cgccgccccggcgacggcggcctgggcgacagcgccgccctcgaggacctgctgcgccgc
gccgcgcggcatggcgccgacgcgctggcgatcagcccgctgcacgccctggccgaggcc
aacggacatgcctacagcccctactcgccgtccagccggctgttcttcaatgtcctgcac
gccgcgccggcgaccattctcggcgcggcggcggtggaacaggcgatccgtcgcgccggc
ctggccgcggagatggcccgcctggagagcctggagctgatcgactggacagcggcggcg
gacctgcgcatgcgcctgctgcgccaactccaccgcgacttcaccgagcgcgccagtccc
ttgcgccacgacctcgccgaattccgccgcgaagccggcgaggccctgctgcaccactgc
cgcttcgagaccctgcaggcgcacctgggcgccggccccgactggagacgctggccggag
ccgctgcgccgccccggcgagccggcggtggccgcgttctgcgccgatcacgccgaggaa
gtggacttccgcgccttcggccagtggctgacccaacgctgcctgcaacatgcccagcgc
caggcgcgcgaggccgggatggccatcggtctggtcgccgacctggcggtgggcgccgat
ggcggcggcagccaggcctggtcgcggcaggaagagctgctcgccgaagtgaatgtcggc
gcgccgccggacatcctcaaccagtccggacaggactggggcgtttccgcgttcaatccc
gaaggcctgcgccgccacggctaccgggcattccgcgagatgctgcgggccaacctggcc
tggcccggagggctacgcatcgaccatgtgatgggcctgcaacgtctctggctgatcccg
cgcggccagccgccccacgccggcgcctacctgcgctacccgcaacgcgagctgctgcgc
ctgctggcgctggaggccagtcgcgcctcggcgctggtcatcggcgaggacctcggcacc
gtgcccgaaggcctgcgcgaggaactggcacgccgccaagtgctgggtacccgcgtgctg
ctcttcgagcggcgcggcgaacgcttcgtgcccccggcgcaatggccggcggacgccatg
gccaccaccagcacccacgacctgccgagcctgtccggctggtggcggggccaggacatc
cactggcgcggccgcgccggacaccgcagcgccgaggaatgcgcggccgacctggaactg
cgcgccgaggagcgccgggcgctggccgccagcctcgaaccgccggtcgatcccgacccc
gccgccgaagtaccgctggacgcctgcatcggctatgtcggggcaacccccgcgccgttg
gtgctactgcccctggaggacgccctgggcagcctggagcagccgaacctgcccggcccc
ggcgacgcccacccgaactggcggcggcgctggccggaaaacgccgcgcagatgctcgga
acgccgcaggtcgaccggcgcctgcgcctgctcgaacgcagccgccggggtgccgaggag
gccgcccatgattga

DBGET integrated database retrieval system