KEGG   Pseudomonas aeruginosa RP73: M062_22310Help
Entry
M062_22310        CDS       T02711                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00380  Tryptophan metabolism
prp00630  Glyoxylate and dicarboxylate metabolism
prp01110  Biosynthesis of secondary metabolites
prp01130  Biosynthesis of antibiotics
prp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M062_22310
  Amino acid metabolism
   00380 Tryptophan metabolism
    M062_22310
Enzymes [BR:prp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     M062_22310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AGO41750
Structure
PDB: 

Jmol
Position
complement(4817703..4819151)
Genome map
AA seq 482 aa AA seqDB search
MEEKTRLTTAAGAPVVDNQNVQTAGPRGPMLLQDVWFLEKLAHFDREVIPERRMHAKGSA
AYGTFTVTHDITPYTRAKIFSQVGKKTDMFLRFSTVAGERGAADAERDIRGFSMRFYTEQ
GNWDLVGNNTPVFYLRDPLKFPDLNHVVKRDPRTNLRNATFKWDFFSHLPESLHQLTIDF
SDRGLPKSYRHIHGFGSHTFSFINANNERFWVKFHFKTQQGIENLTNAEAAEVIAQDRES
SQRDLYESIEKGDFPRWKMYVQIMPEKEAATYRYNPFDLTKVWPHGDYPLIEVGFFELNR
NPDNYFAEVEQAAFTPANVVPGIGFSPDKMLQGRLFSYGDAHRYRLGVNHHQIPVNAARC
PHQVYHRDGGMRVDGNNAHQRVTYEPNSFNQWQEQPDFSEPPLSLEGAADHWNHRVDDDY
YSQPAALFHLFTDEQKQRLFANIAEDIRDVPEQIQRRQIGLFLKVDPAYGKGVADALGLK
LD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagacccgcctgaccactgccgctggcgcaccggtggtcgataaccagaac
gtgcagaccgccggtccgcgtggcccgatgttgctgcaggacgtgtggttcctcgagaag
ctcgcccacttcgatcgcgaagtgatccccgagcgacgcatgcatgcgaaaggctccgcg
gcctacggcaccttcaccgtcacccatgacatcaccccctacacccgggcgaagatcttc
tcccaggtcggcaagaagaccgatatgttcctgcgcttctccaccgtcgccggtgagcgt
ggcgcggcggatgccgagcgtgacatccgcggcttctccatgcgtttctacaccgagcag
ggcaactgggacctggtcggcaacaacaccccggtgttctatctgcgcgacccgctcaag
ttccccgatctcaaccacgtggtgaagcgtgacccgcgcaccaacctgcgcaatgcgacc
ttcaagtgggactttttctctcacctccccgagtcgctgcatcagttgaccatcgacttc
agcgaccgcggcctgccgaagagctatcggcacatccatggtttcggcagccataccttc
agcttcatcaatgcgaacaacgagcgcttctgggtcaagttccacttcaagacccaacag
ggcatcgagaacctgaccaacgccgaggccgccgaagtgatcgcccaggaccgcgagagt
tcgcagcgcgacttgtacgagagcatcgagaaaggcgacttcccgcgctggaagatgtac
gtgcagatcatgcccgagaaggaagcggctacctatcgctacaacccgttcgacctgacc
aaggtctggccccacggtgactacccgttgatcgaagtgggcttcttcgagctgaaccgt
aacccggacaactacttcgccgaggtcgagcaggccgctttcacgccggccaacgtggtg
cccggtatcggtttctcgccggacaagatgctccagggccgtctgttctcctacggcgac
gcccatcgctatcgcctgggcgtcaaccaccaccagatcccggtgaacgccgcgcgttgc
ccgcaccaggtctaccaccgcgacggcggcatgcgggtggacggcaacaacgcccatcag
cgcgtcacctacgagccgaacagcttcaaccagtggcaggagcagcctgacttctccgag
ccgccgctgagcctggagggcgcggcggaccactggaaccaccgggtggacgacgactac
tacagccagcccgccgcgctgttccatctgttcaccgacgagcagaagcagcggctgttc
gccaacatcgccgaagacatccgcgatgtaccggaacagatccagcgtcgccagatcggc
ctgttcctcaaggtcgacccggcctacggcaaaggcgtcgccgacgccctcggcctgaag
ctggactga

DBGET integrated database retrieval system