KEGG   Pseudomonas aeruginosa RP73: M062_24035Help
Entry
M062_24035        CDS       T02711                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00330  Arginine and proline metabolism
prp00332  Carbapenem biosynthesis
prp01100  Metabolic pathways
prp01130  Biosynthesis of antibiotics
prp01230  Biosynthesis of amino acids
Module
prp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M062_24035
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    M062_24035
Enzymes [BR:prp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     M062_24035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGO42058
Position
complement(5179871..5180989)
Genome map
AA seq 372 aa AA seqDB search
MRDKVTGARRWVVKIGSALLTADGRGLDRNAMAVWVEQMVALHCAGIELVLVSSGAVAAG
MSRLGWVSRPSAMHELQAAASVGQMGLVQAWESSFALHGLQTAQVLLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAQLIYEARADDPQLDAVAGGSAGALGRGGMQTKLRAARLAARSGGHTVIVGG
RIERVLDRLRAGERLGTLLTPDRSRKAARKQWLAGHLQMRGTLVLDDGAVKAVSQDHKSL
LPVGVKAVQGSFRRGEMVVCVDQGGREVARGLVNYSALEAQKILGQPTDAIEALLGYVDG
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgactggcgcgcggcgctgggtggtgaagatcggtagcgccctgctg
acggccgatggccgtgggctggatcgcaatgccatggccgtttgggtcgagcagatggtg
gcgctgcattgcgccggcatcgagctggtgctggtgtcgtccggcgccgtcgccgccggt
atgagccgcctgggctgggtgtcccgacctagcgcgatgcacgaactccaggccgccgcc
tcggtggggcaaatggggttggtgcaggcctgggagtccagcttcgccctgcatggcctg
cagaccgcccaggtgttgctgacccatgacgacctctccgaccgcaagcgctacctgaac
gcccgcagcaccctgcggaccctggtcgagctgggcgtggtcccggtgatcaacgagaac
gacacggtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcactggtg
gccaacctggtcgaggccgacctgctggtgatccttaccgatcgcgacgggatgttcgac
gccgatccgcgcaacaatcccgatgcccaactgatctacgaggcgcgtgccgatgatccg
cagctcgatgcggtggccggcggcagtgccggcgccctggggcgcggcggaatgcagacc
aagctgcgggcggcgcgcctggcggcgcgttccggcgggcatacggtgatcgtcggtggg
cgtatcgagcgtgtcctcgaccgcctgcgcgccggcgaacgcctcggcaccctgttgacc
cctgatcgcagtcgcaaggcggcgcgcaagcaatggctggccggccacttgcagatgcgc
ggcaccctggtgctggacgatggggcggtgaaggcggtgagccaggatcacaagagcctg
ttgccggttggggtcaaggcggtccagggcagcttccgtcgcggcgagatggtggtctgt
gtggaccagggcgggcgcgaagtggcgcgcggcctggtcaactacagtgcgttggaggcg
cagaagatcctcggtcagccgacggatgccatcgaggccttgcttggctacgtggatggg
ccggagctggtgcatcgcgacaatctggttctggtctga

DBGET integrated database retrieval system