KEGG   Pseudomonas aeruginosa RP73: M062_24285Help
Entry
M062_24285        CDS       T02711                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M062_24285
  Amino acid metabolism
   00380 Tryptophan metabolism
    M062_24285
Enzymes [BR:prp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     M062_24285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5236580..5238121)
Genome map
AA seq 513 aa AA seqDB search
MNPSLNAFRPGRLLVAASLTASLLSLSVQAATLTRDNGAPVGDNQNSQTAGPNGSVLLQD
VQLLQKLQRFDRERIPERVVHARGTGAHGEFVASADISDLSMAKVFRKGEKTPVFVRFSA
VVHGNHSPETLRDPRGFATKFYTADGNWDLVGNNFPTFFIRDAIKFPDMVHAFKPDPRSN
LDDDSRRFDFFSHVPEATRTLTLLYSNEGTPASYREMDGNSVHAYKLVNARGEVHYVKFH
WKSLQGQKNLDPKQVAEVQGRDYSHMTNDLVSAIRKGDFPKWDLYIQVLKPEDLAKFDFD
PLDATKIWPGIPERKIGQMVLNRNVDNFFQETEQVAMAPSNLVPGIEPSEDRLLQGRLFA
YADTQMYRVGANGLGLPVNRPRSEVNTVNQDGALNAGHSTSGVNYQPSRLDPREEQASAR
YVRTPLSGTTQQAKIQREQNFKQTGELFRSYGKKDQADLIASLGGALAITDDESKYIMLS
YFYKADSDYGTGLAKVAGADLQRVRQLAAKLQD
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttccctgaacgccttccgtcccggccgcctgctggtggcggcaagcctgacc
gccagcctcctgtcgctgtccgtgcaggccgcgaccctgacccgtgacaacggtgcgcca
gtgggcgacaaccagaactcgcagaccgccgggcccaacggttcggtgctgctgcaggac
gtgcaactgctgcagaagttgcaacgtttcgaccgcgagcgcattcccgaacgcgtggtg
catgcccgcggcaccggcgcccatggcgagttcgtcgccagcgccgatatcagcgacctg
agcatggccaaggtcttccgcaagggcgagaagaccccggtattcgtgcgcttctccgct
gtggtgcacggcaaccactccccggaaaccctgcgcgatccgcgcggtttcgccaccaag
ttctataccgcagacggcaattgggacctggtgggcaacaacttcccgaccttcttcatc
cgcgatgcgatcaagttcccggatatggtccatgccttcaagccggacccgcgcagcaac
ctcgacgacgactcgcgacgcttcgatttcttctcccacgtgccggaggcgacccgcacc
ctgaccctgctgtattccaacgagggcaccccggccagctaccgggaaatggacggcaac
agcgtgcatgcctacaagctggtcaacgccaggggcgaagtgcactacgtgaagttccac
tggaagagcctgcagggccagaagaacctcgatccgaaacaggtggcggaagtccagggt
cgcgactacagccacatgaccaatgacctggtgagcgcgatccggaagggcgacttcccg
aaatgggacctgtacatccaggtgctcaagcccgaggacctggcgaaattcgacttcgat
ccgctggacgcgaccaagatctggccgggcattcccgagcgcaagatcggccagatggtg
ctgaaccgcaacgtcgacaacttcttccaggaaaccgaacaggtcgccatggcgccgtcg
aacctggtgccgggcatcgagccctccgaggatcgcctgctccagggacggctgttcgcc
tacgccgacacccagatgtaccgggtcggcgccaacggcctgggcctgccggtcaaccgc
ccgcgcagcgaggtcaataccgtcaaccaggacggcgcgctgaacgccggacacagtacc
agcggggtgaactaccagccgagccggctcgatccacgcgaggagcaggccagcgcccgc
tacgtgcggaccccgctgagcggcaccacccagcaggcgaagatccagcgcgagcagaac
ttcaagcagaccggcgagctgttccgctcctacggcaagaaggaccaggccgacctgatc
gccagtctcggcggggcgttggcgatcaccgacgacgagagcaagtacatcatgctttcc
tacttctacaaggctgacagcgactacggtacgggcctggccaaggtggccggggccgat
ctgcagcgcgtccggcaactggcggcgaagctccaggattga

DBGET integrated database retrieval system