KEGG   Prevotella ruminicola: PRU_0012Help
Entry
PRU_0012          CDS       T01212                                 

Definition
(GenBank) putative pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
pru  Prevotella ruminicola
Pathway
pru00040  Pentose and glucuronate interconversions
pru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PRU_0012
Enzymes [BR:pru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PRU_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase DUF1565 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADE82952
UniProt: D5EUV8
Position
complement(18188..19162)
Genome map
AA seq 324 aa AA seqDB search
MKKLLLLLAIMASSQVSLAAGKYDNPDTIVVARDGTGQFRTIDEAIEVCRAFMDYHKVIF
VKNGTYKEKLIIPSWLQNIEICGEDAEKTIITYDDHANIARAETGKPMGTFRTYTLKIEG
NDITLKNITIENNSARLGQAVALHTEGDRLVFVGCRFIGHQDTVYTGVAGTRLYFKDCFI
CGTTDFIFGPSTAWFEGCTIESRINSYVTAASTPQDQPYGYIFNNCRLIATPEATQVYLG
RPWRDYGYTLFMNCELGSHIRPEGWHHWEKHREQTARYLEYNNRGAGANISQRVPWSRQL
TKKEAAKITPQTVFNKNDGWSPRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactactgctattactcgccatcatggcctcttctcaagtcagcttagctgct
ggcaaatacgacaaccccgataccattgtggttgctcgcgatggcacgggccagttccgc
accatcgacgaagctatcgaggtgtgccgtgcatttatggattaccacaaggtgattttt
gtaaagaacggcacttataaggaaaaactgattatcccttcgtggttgcagaacatcgag
atttgcggtgaggatgccgagaaaaccatcatcacctacgacgaccatgccaacatcgcc
cgtgccgagacaggcaagcccatgggcacgttccgcacatacaccctgaagattgagggc
aatgatatcacgctgaagaatatcaccatcgagaacaactcagcccgcttgggtcaggca
gtggcactgcataccgagggcgaccgactggtatttgtaggctgccgattcatcggtcat
caggatacggtctacaccggagtggcaggcacgcgcctgtacttcaaagactgttttatc
tgcggcaccaccgattttatcttcggtccctctacagcctggttcgagggttgcaccatc
gagagtcgtatcaactcatacgtcacagcagcctcaacaccacaggatcagccttacggc
tacatcttcaacaactgccgtctgatagctacccctgaggctacgcaggtttatttgggt
cgcccttggcgcgactatggctatacgctctttatgaactgcgagttaggcagccacatc
cgtcctgagggctggcatcactgggagaagcaccgtgagcagaccgcccgctacttagag
tacaacaaccgtggtgccggtgctaacatcagccagcgtgtgccctggagccgccagctc
accaagaaagaggccgctaagattacaccccaaacagtattcaacaaaaatgatggttgg
agccctaggaaataa

DBGET integrated database retrieval system