KEGG   Prevotella ruminicola: PRU_0012Help
Entry
PRU_0012          CDS       T01212                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pru  Prevotella ruminicola
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PRU_0012
   00500 Starch and sucrose metabolism
    PRU_0012
Enzymes [BR:pru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PRU_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(18188..19162)
Genome map
AA seq 324 aa AA seqDB search
MKKLLLLLAIMASSQVSLAAGKYDNPDTIVVARDGTGQFRTIDEAIEVCRAFMDYHKVIF
VKNGTYKEKLIIPSWLQNIEICGEDAEKTIITYDDHANIARAETGKPMGTFRTYTLKIEG
NDITLKNITIENNSARLGQAVALHTEGDRLVFVGCRFIGHQDTVYTGVAGTRLYFKDCFI
CGTTDFIFGPSTAWFEGCTIESRINSYVTAASTPQDQPYGYIFNNCRLIATPEATQVYLG
RPWRDYGYTLFMNCELGSHIRPEGWHHWEKHREQTARYLEYNNRGAGANISQRVPWSRQL
TKKEAAKITPQTVFNKNDGWSPRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactactgctattactcgccatcatggcctcttctcaagtcagcttagctgct
ggcaaatacgacaaccccgataccattgtggttgctcgcgatggcacgggccagttccgc
accatcgacgaagctatcgaggtgtgccgtgcatttatggattaccacaaggtgattttt
gtaaagaacggcacttataaggaaaaactgattatcccttcgtggttgcagaacatcgag
atttgcggtgaggatgccgagaaaaccatcatcacctacgacgaccatgccaacatcgcc
cgtgccgagacaggcaagcccatgggcacgttccgcacatacaccctgaagattgagggc
aatgatatcacgctgaagaatatcaccatcgagaacaactcagcccgcttgggtcaggca
gtggcactgcataccgagggcgaccgactggtatttgtaggctgccgattcatcggtcat
caggatacggtctacaccggagtggcaggcacgcgcctgtacttcaaagactgttttatc
tgcggcaccaccgattttatcttcggtccctctacagcctggttcgagggttgcaccatc
gagagtcgtatcaactcatacgtcacagcagcctcaacaccacaggatcagccttacggc
tacatcttcaacaactgccgtctgatagctacccctgaggctacgcaggtttatttgggt
cgcccttggcgcgactatggctatacgctctttatgaactgcgagttaggcagccacatc
cgtcctgagggctggcatcactgggagaagcaccgtgagcagaccgcccgctacttagag
tacaacaaccgtggtgccggtgctaacatcagccagcgtgtgccctggagccgccagctc
accaagaaagaggccgctaagattacaccccaaacagtattcaacaaaaatgatggttgg
agccctaggaaataa

DBGET integrated database retrieval system