KEGG   Prevotella ruminicola: PRU_0082Help
Entry
PRU_0082          CDS       T01212                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pru  Prevotella ruminicola
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PRU_0082
Enzymes [BR:pru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PRU_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103020..105383
Genome map
AA seq 787 aa AA seqDB search
MKKVKLLITALLLTFAQFASAGDFTVGNKTFLLNGEPFVVKAAEVHYPRIPRPYWEHRIK
MCKALGMNTLCIYVFWNIHEQREGQFDFTDNNDVAEFCRLAQKNGMYVIVRPGPYVCAEW
EMGGLPWWLLKKKDIRLRERDPYFLERVKIFEQKVGEQLAPLTIQNGGPIIMVQVENEYG
SYGEDKPYVSEIRDCLRGIYGEKLTLFQCDWSSNFERNGLDDLVWTMNFGTGANIDHEFA
RLKQLRPNAPLMCSEFWSGWFDKWGANHETRPAKDMVDGMDEMLSKNISFSLYMTHGGTS
FGHWAGANSPGFAPDVTSYDYDAPINEYGGTTEKFFQLRKMMQKYSKTPLPAIPARPANM
INIPAFEMREHADILLGADSLVMNSPLRTMEELNQGWGSMVYITSLPDIDTPSVLTLNDG
HDFAQVFIDSTYIGKIDRVRNEKSLLLPAVKKGQELKILIEAMGRINFGRAIKDYKGITE
SVTLSTDKDGHELIWNLKRWDIFTIPDSYAAAKKALDTAKRDSLTKMVFKGSGYYRGYFN
LKRVGDTFLNMENWGKGQVYVNGHAIGRFWSIGPQQTLYVPGCWLKKGKNEVVVLDVVGP
SAKAFYFTKDKKRLSPWLFAQNKPELDKLNVEKSRTHNDPANQPDLNSATPAHVGQLAAD
NGWQMVRFAAPQTGRYLAIQALSTHEGKDVVSVAELYAVNAVGARLSREPWTVKYADSEE
TKRGNNTAEKSFDLQESTYWRTERGAALPHLMVIDLGSEQTITGFDYLPRAEEGAPGSIK
DYKIFVY
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttaaactactgattactgctttattgctcacttttgctcagtttgctagt
gctggcgattttactgttggaaacaaaactttcctgcttaatggcgagccttttgtggtt
aaggcggccgaggttcactatccgcgtatcccccgtccatattgggaacatcgcataaaa
atgtgtaaggctttaggtatgaacaccctctgtatctatgtgttctggaatatccatgaa
cagcgcgagggacagttcgatttcactgataataatgatgtggctgagttctgccgactg
gcccagaaaaatggcatgtacgtgattgtccgtcctggtccatacgtatgtgccgagtgg
gagatgggcggtctgccttggtggctgctcaagaagaaagatatccgtctgcgcgagcgc
gatccttatttcttggagcgtgtaaaaatcttcgagcagaaagtgggcgagcagttagct
cccctcaccattcagaatggtggtcctatcatcatggtgcaggtagagaatgagtatggc
tcgtatggcgaggataaaccctatgtctctgagattcgcgattgcctgcgtggcatctac
ggcgaaaaactcacactgttccagtgcgactggagttcaaacttcgaaagaaacggtctc
gacgatttggtttggaccatgaacttcggtactggtgctaatatcgatcacgagtttgca
cgtctcaagcagttgcgccccaatgcccctctgatgtgctctgagttctggagcggttgg
ttcgataagtggggggctaatcacgaaacacgccctgccaaggatatggtggatggtatg
gacgagatgctgtcaaagaatatctcgttctcgctctatatgacacatggcggtacctcg
tttggtcattgggcaggtgctaactcgccaggtttcgcacctgatgtaaccagttacgat
tacgatgctcctatcaacgagtatggtggcaccaccgagaagtttttccagttgcgtaag
atgatgcagaagtacagcaaaacaccgctgcctgctatccccgcgcgccctgctaacatg
attaatatccctgccttcgagatgcgcgagcatgccgatattctgctgggtgccgacagt
ctggtgatgaacagtccgctgcgcaccatggaggaacttaatcagggctggggctcgatg
gtatatatcacctcgctgcccgatatcgatacccctagtgtgcttaccctcaacgatgga
cacgactttgcacaggtgttcatcgatagtacctatatcggtaagattgatcgtgtacgc
aacgaaaagagccttctgttgccagccgtaaagaaaggtcaggaacttaagattcttatc
gaggctatgggtcgtatcaactttggtcgtgccatcaaggattacaagggcatcaccgag
agtgtcaccctgtcaaccgataaggatggtcacgagcttatctggaacctgaagcgctgg
gatatctttactattcccgatagctatgcagctgccaagaaggcactcgatacagccaag
cgcgattcgcttactaaaatggtgttcaagggttcaggctattatcgtggctatttcaac
ctcaagagggtaggcgataccttcctgaatatggagaactggggcaagggtcaggtatat
gtcaatggtcatgctattggtcgtttctggtctattggtcctcagcaaaccctctatgtg
ccaggttgctggcttaagaagggtaagaacgaggtcgttgtgctcgatgtggtaggtcct
tctgctaaggcattctacttcactaaggacaagaagcgcctttcaccttggctctttgcg
cagaataagcctgaactcgataaactaaatgttgaaaaatctcgtacacataacgatcct
gctaatcagcccgatctcaactctgcaactccagcccatgtaggtcagttggcagccgat
aatggttggcagatggtacgttttgctgcaccacagacaggtcgctatctcgctatccag
gccttatctacccacgaaggtaaggatgtggtatctgtagccgaactctatgccgttaat
gctgttggcgcacgcctcagtcgtgaaccttggacagtaaaatatgctgatagcgaggag
acgaagcgtggtaataatactgctgaaaaatctttcgatttgcaggagtcaacttactgg
cgtactgagcgtggcgcggcactgccacatctgatggtcatcgaccttggtagcgagcag
acgattactggtttcgattacttgccacgtgccgaggaaggtgccccaggtagcatcaag
gattacaaaatctttgtgtattaa

DBGET integrated database retrieval system