KEGG   Prevotella ruminicola: PRU_0241Help
Entry
PRU_0241          CDS       T01212                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pru  Prevotella ruminicola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PRU_0241 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_0241 (glkA)
   00052 Galactose metabolism
    PRU_0241 (glkA)
   00500 Starch and sucrose metabolism
    PRU_0241 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    PRU_0241 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PRU_0241 (glkA)
   00524 Butirosin and neomycin biosynthesis
    PRU_0241 (glkA)
Enzymes [BR:pru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PRU_0241 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281440..282423
Genome map
AA seq 327 aa AA seqDB search
MNEQNAEIKPYVIGLDLGGTNSVFGIVDARGDIKATTAIKTGGYSNVDDYVAASVEALQP
IIEQVGGIEKIKAMGIGAPNGNYYNGTIEFAPNLPWAHNGVVPLAKLFSDALGIPVALTN
DANAAAIGEMVYGVARGMKNFIVITLGTGVGSGIVVNGQLLYGHDGFAGELGHVTMVRGE
EGRACGCGRTGCLECYCSATGVARTAREMLAKTDRPSLLRDMNPEDITSLDVSIAAGKGD
ELAKDIYEFTGKMLGEACADFAAFSSPEAFIFFGGMVKAGELIMKPIREAYDAHVLKIFK
NKAKFLVSGLDGASAAVLGASAIGWEV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacagaacgcagaaattaagccttacgttattggcttagacttaggaggtacc
aattcggtatttggtattgttgatgcccgtggcgatatcaaggccaccacagccatcaaa
actggtggttacagtaatgtagatgattacgtagccgcatcggtcgaggctttgcagcct
atcatcgagcaggttggcggtatcgagaaaatcaaggccatgggtattggtgctcctaac
ggcaactattataacggcacaatcgagtttgctcctaatctgccttgggcccacaatggt
gtagtgcccctggctaagctgttcagcgatgcattaggcattcccgtagcccttaccaac
gatgctaatgccgctgctatcggcgagatggtttacggtgtggctcgtggcatgaagaac
ttcatcgttatcactcttggtaccggtgtaggttcgggtattgttgttaacggtcagttg
ctttacggtcacgatggttttgctggcgagctgggtcacgtaacaatggttcgtggcgag
gaaggtcgcgcttgcggatgcggtcgtacaggctgcttggagtgctactgctcggctact
ggtgtggctcgtactgctcgcgagatgctggcaaaaaccgatcgtccatcactgctgcgc
gacatgaaccccgaggatatcacatcgctcgatgtatcaatcgctgctggtaagggcgac
gagctggctaaggatatctacgagtttactggtaagatgcttggcgaggcttgtgccgat
ttcgctgccttctcatcacccgaggcattcatcttctttggtggtatggttaaggccggc
gagctgattatgaaacctatccgcgaggcttacgatgcccacgttcttaagatcttcaag
aacaaggccaagttcctcgtttcaggtctcgatggcgcaagtgcagccgttctcggtgcc
tcagccatcggttgggaagtataa

DBGET integrated database retrieval system