KEGG   Prevotella ruminicola: PRU_0427Help
Entry
PRU_0427          CDS       T01212                                 

Gene name
galM_2
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pru  Prevotella ruminicola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_0427 (galM_2)
   00052 Galactose metabolism
    PRU_0427 (galM_2)
Enzymes [BR:pru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PRU_0427 (galM_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(517960..519051)
Genome map
AA seq 363 aa AA seqDB search
MANTTETVNLCGLKRENFQATINGKKTDLYILRNRKGFEVAISNYGGAICAIMVPGKDGK
VANVIQGHDSIEQLTSGNEPYLSTLIGRWGNRICKGQFILNGKEYQLALNDGPNHLHGGS
VGFNAKVWDARQMGPRSLALHRISSYGEEGFTGELDVTVEFTFTDNNELVIEYLATTNKK
TIVNLTHHAFFSLAGTADPTPSIDDQICEINADFYLPTDATAIPTGEILKVEGTPFDFRK
PKAFGQDINADHEQIKFGHGFDHNYVLNKQEEGELSFAAKVTDPKSGRTMEVYTTEPGLQ
LYTGNFLSGYKGANGCTFPHRSAVCFEAQHFPDSPNRPYFPSVVLNPGQRYKQKTVYRFG
VVE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacactacagagacagtgaatctgtgcggcttgaagcgtgagaacttccaggcc
actattaacggtaaaaaaaccgacttgtatattcttagaaaccgtaaaggattcgaagtt
gccatctcaaactatggcggtgccatttgtgctattatggttcccggcaaggatggtaaa
gtagctaacgttatccagggtcacgacagcatcgagcagctgaccagcggaaacgagcct
tatctgtcgactctgatcggccgttggggtaaccgtatctgcaaaggccagttcattctg
aacggcaaggagtaccagctggctcttaacgatggacctaaccacctgcacggcggttca
gtaggtttcaacgctaaggtttgggacgcccgtcagatgggtcctcgctctttggctctg
caccgtatctcttcttatggtgaggaaggtttcacaggcgagctggatgtaacagtagaa
tttacctttaccgacaacaacgaactggtaatcgagtacctggctactaccaacaagaag
acaatcgttaatctgacacaccacgccttcttctcactggctggtactgccgatccaaca
ccaagtatcgacgatcagatttgcgagatcaatgccgacttctatctgcctaccgacgct
actgctatcccaacaggtgagatcctgaaggttgagggcactccattcgacttccgcaag
ccaaaggcattcggacaggacatcaacgccgatcacgagcagattaagttcggacacggt
ttcgaccacaactacgtactgaacaagcaggaagagggcgagctctcattcgctgccaag
gttaccgacccaaagagcggccgtactatggaggtttacaccaccgagccaggcctgcag
ctttacacaggtaacttcctgagcggctataagggcgctaatggttgcaccttcccacat
cgttcagctgtctgcttcgaggcccagcacttccccgattcacctaaccgtccatacttc
ccaagtgtggttctgaatccaggacagcgctacaagcagaagaccgtataccgctttgga
gtggtagagtag

DBGET integrated database retrieval system