KEGG   Prevotella ruminicola: PRU_0476Help
Entry
PRU_0476          CDS       T01212                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pru  Prevotella ruminicola
Pathway
pru00010  Glycolysis / Gluconeogenesis
pru00030  Pentose phosphate pathway
pru00051  Fructose and mannose metabolism
pru00680  Methane metabolism
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
pru01120  Microbial metabolism in diverse environments
pru01130  Biosynthesis of antibiotics
pru01200  Carbon metabolism
Module
pru_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_0476
   00030 Pentose phosphate pathway
    PRU_0476
   00051 Fructose and mannose metabolism
    PRU_0476
  Energy metabolism
   00680 Methane metabolism
    PRU_0476
Enzymes [BR:pru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PRU_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 UVR
Motif
Other DBs
NCBI-ProteinID: ADE82265
UniProt: D5EXL7
Position
complement(572490..574463)
Genome map
AA seq 657 aa AA seqDB search
MKHLTGNETDLHYLQLLAQSFPTVADASTEIINLEAIMALPKGTEHFLADIHGESEAFRH
ILKNASGNIKRKVNELFGNDIRESEKKELCTLIYYPEEKLELIKAQEKDIEDWYRITIHQ
LVKVCRDVSSKYTRSKVRKSLPQDFAYIIEELLHESLSDNDKAAYVSVIVNTIISTGRAD
DFICAICNVIQRLAIDQLHILGDIYDRGPGAHIIMDTLRQYHSWDIQWGNHDVLWMGASA
GNDACICNVLRLCLRYANLTTIEEYGINLVPLATFALDVYGNDPCLEFQPKLLPGNTMDE
KTKQLTAKMHKAIAVLQFKTEAEIFTRRPEWQMTDRCMLSMVNYEKGTCNIDGKDYEMKS
CNFPTVDPLHPNKLTAEEADLMQKLHHSFRISEKLHKHINTLLSHGCMYTISNSNLLFHA
AIPLNDDGSLKEIEIYPGRKYSGKELMHNIGMMIREAFQNDSDDKDYARDYFLYLWCGKE
SPLFCKSKMATFERYFLVDKDTYKEEKGNYFKLRDSEEVCDRILDAFGVKGTNRHIINGH
VPVHAGSGENPIKAGGKLMVIDGGFSEAYHKETGIAGYTLVYHSRGFQLVQHEPFTSARD
AIAREIDIKSTTQIIEMSAHRMLVADTDKGEELRAQIADLKELLYAYRHGIITERRR
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcttaccggcaatgaaactgatctgcactacttgcaactgttagcacaatcg
ttccccacggttgccgacgcctcaaccgagattatcaacctcgaggctatcatggcgctg
cctaagggcaccgagcactttctggccgatattcacggcgagagcgaggctttccgccat
atcctgaagaatgcctcgggtaacatcaagcgtaaggtaaacgagctgtttggcaacgat
atccgtgagagcgagaagaaagagttgtgcaccctgatatactaccccgaagagaaactg
gagctgattaaggctcaggaaaaagatatagaggactggtaccgcattaccatccaccaa
ctggtaaaagtgtgccgcgacgtgagcagcaagtacacccgctcgaaggtgcgcaaatcg
ctgccacaggattttgcctacatcatcgaggagctactacacgagagtctgagcgacaac
gataaggccgcctacgtgagcgtgattgtaaacaccatcatctctacaggtcgtgctgat
gattttatctgcgccatctgtaatgtgatccagcgcctggccatcgaccagctgcatatt
cttggcgacatctacgatcgtggtcctggtgcccacatcatcatggacaccctgcgccaa
taccactcgtgggacatccagtggggcaatcacgatgtgctgtggatgggtgcttcggct
ggtaacgatgcctgtatctgcaacgtgctgcgcctgtgcctgcgttatgccaacctgact
accatcgaggagtacggtattaacctggtacccctggccacctttgcactcgacgtgtat
ggcaacgacccctgtctggagttccagcccaagctgctgccaggcaacacgatggacgag
aagaccaagcagctcaccgccaagatgcacaaggccatcgccgtgctgcagtttaagacc
gaggccgagatatttacccgccgccccgagtggcagatgaccgaccgttgtatgctcagt
atggtaaactacgaaaagggcacctgcaacatcgatggtaaggattacgagatgaagagc
tgtaacttccccaccgttgatcccctgcatcctaacaagctcaccgccgaggaggccgac
ctgatgcagaagctgcaccactcgttccgcatcagcgaaaagctgcacaagcatatcaac
acactgctgtcgcacggctgcatgtacaccatcagcaacagcaacctgctgttccacgcc
gccatcccgctcaacgacgatggttcgctcaaggagatagagatctatccaggcaggaaa
tactcgggcaaggagctgatgcacaatatcggcatgatgatccgcgaggccttccagaac
gattcggatgataaggattacgcccgcgattacttcctgtacctgtggtgcggtaaggag
tcgcccctgttctgtaagtcgaagatggccaccttcgagcgctatttcctggtagataaa
gacacctataaggaggagaaaggcaattactttaagctgcgtgacagcgaggaggtttgc
gaccgcatactggatgccttcggcgtaaaaggcaccaaccgccatattatcaacggtcac
gtgcccgtacatgccggtagcggcgagaatcctatcaaggcaggcggcaagctcatggtg
attgatggtggtttctccgaggcctatcacaaggagactggtattgccggctacaccctg
gtatatcactcgcgcggtttccaactggttcagcacgagccgttcacctcggcccgcgat
gctatagcacgcgaaatagatattaaatctaccacacagattatcgagatgtcggcccat
cgcatgctggtggccgataccgataagggcgaagagctgcgcgcgcagattgccgacctg
aaggagctgctttacgcctatcgtcacggtataattactgagcgccgccgatga

DBGET integrated database retrieval system