KEGG   Prevotella ruminicola: PRU_0637Help
Entry
PRU_0637          CDS       T01212                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pru  Prevotella ruminicola
Pathway
pru00240  Pyrimidine metabolism
pru00250  Alanine, aspartate and glutamate metabolism
pru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PRU_0637 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PRU_0637 (pyrB)
Enzymes [BR:pru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PRU_0637 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADE82246
UniProt: D5EYF6
Position
complement(746888..747835)
Genome map
AA seq 315 aa AA seqDB search
MKKHNFVTIADLTREKILYMIEMAQEFEKHPNRELLKGKVVATLFFEPSTRTRLSFETAA
NRLGARVIGFADPKITSGTKGETLKDTILMVSNYADVIVMRHYIEGAAQYASEVAPVPIV
NAGDGAHQHPSQCMLDLYSIYKTQGTLENLNIYLVGDLKYGRTVHSLIMAMRHFNPTFHF
VAPKELAMPKEYKIYCDEHGIKYQEHTAFNEKVIADADILYMTRVQKERFSDLMEYERVK
NVYVLNNDLLKNAKPNMKILHPLPRVNEIAYEVDDNPHAYYIQQAGNGLFAREAIFCDVL
GITLDEVKTDKTIIH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcataattttgtaacaattgccgatctcactcgagagaagatcctctacatg
attgagatggcgcaagagttcgagaagcaccccaatcgtgagttgctgaagggcaaagtt
gtggcaacccttttcttcgaaccctcaacccgaacccgacttagttttgaaacagcagct
aaccgtctgggtgcccgtgttatcggatttgccgatccgaagattaccagcggcaccaag
ggcgagacactgaaggacaccatcctgatggtatcgaactacgccgacgtgattgtgatg
cgccattatatcgaaggcgccgctcaatatgcttcggaggtagccccagtgcccatcgtg
aatgccggcgacggcgcacatcagcacccctcgcagtgtatgcttgacctctactcgatc
tacaagacgcagggcacgctggagaatctgaacatctatctggtgggcgacctgaaatac
ggacgaacggtacactcgctgattatggccatgaggcacttcaaccccaccttccacttt
gtggcgccgaaggaactggccatgccgaaggaatacaagatttattgcgacgaacacggc
attaagtatcaggagcacacggcgtttaacgagaaggtgatagccgatgccgacatatta
tatatgacgcgcgtgcaaaaagaaagattcagcgacctgatggaatacgaacgcgtaaag
aacgtatatgtgctgaacaacgacctgctgaaaaacgccaaacctaacatgaagatattg
cacccgctgccacgcgtaaacgagattgcctacgaggtggacgacaacccacatgcttac
tacatacaacaggccggtaacggactgtttgcccgcgaggccatcttctgcgatgtgctg
ggaattacactcgacgaagttaaaacagataaaactattattcattga

DBGET integrated database retrieval system