KEGG   Prevotella ruminicola: PRU_0656Help
Entry
PRU_0656          CDS       T01212                                 

Definition
family 3 glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pru  Prevotella ruminicola
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pru00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pru00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769022..770197
Genome map
AA seq 391 aa AA seqDB search
MKIFKTWITAAVLFGGLLLTACTNDDNPSGSSAGSVEEQLRKMTLREKVGQMFYVRPEAL
DTTIHWSSFEELSPYKLQQINDCMAGVVKNYPIGGMILYAWNIEDENQLSSFISQIRALN
GSPLLCIDEEGGRVSRLANHPNFNLPKYESMESIGETGDPANAYECANTIGTYLTRYGFD
IDFAPVADVNTNPDNVVIGKRAFSSDPAVAASMVTSYLQGLKDAGITGCIKHFPGHGDTT
ADTHYGYAKSMKTWDEMMDCEMVTFRAGIAWGCELIMTAHIATPNVTGTDEPATMSPVIL
KDKLRGELGYRNIIVTDAISMGAITKQYTNAEAAVGCIKAGADIVLDPRNLVEAFDAVIA
AVNDGTLSEARINQSVRRILTLKQQIRNRTK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttttaaaacatggattaccgccgcagtgctttttggcggattgctgttaaca
gcttgtactaacgatgacaaccccagtggcagctcggccggtagcgttgaggagcagctg
cgaaaaatgacccttcgtgaaaaagtaggtcagatgttctacgtgcgccccgaggccctc
gacaccacgatacactggagcagtttcgaagaactttcgccctacaaactgcagcagatt
aacgattgcatggcaggtgtggttaagaactatcccataggtggcatgatactctatgcc
tggaacatcgaagatgaaaaccaactctcttctttcatctcgcagatacgtgctctcaat
ggtagtccgttgctgtgtatcgacgaggagggcggtcgcgtgtcgcgcctggccaaccat
cccaacttcaatctgcccaaatatgagtcgatggagtcgattggcgaaaccggcgatccc
gccaatgcctacgagtgcgctaacaccatcggcacctatcttacccgttatggtttcgac
atcgattttgccccagtggccgatgtcaacaccaatcccgacaatgttgtgattggtaag
cgcgccttcagtagcgatccggctgtggcagcatccatggtaaccagctacctgcagggg
ctgaaagatgctggcatcacgggctgcatcaagcatttccccggacatggcgacaccact
gccgacacccattacggctatgccaaatctatgaagacctgggacgagatgatggattgc
gagatggtaaccttccgtgcaggtatcgcctggggctgcgagctgattatgactgcccac
attgcaacccccaacgtgactggtactgatgagcccgccaccatgtcgcccgtcatcctt
aaggataagctgcgtggcgagttaggctatcgtaacatcatcgttaccgacgccatcagc
atgggcgccattaccaagcagtacaccaacgccgaagccgctgtgggctgtatcaaggcc
ggtgcagatatcgtgctcgatccccgcaatctggtcgaggccttcgatgccgtgatagcc
gccgttaacgatggcaccctcagcgaggcccgcatcaaccagagtgttcgccgcatccta
accctcaagcagcaaatccgcaaccgcaccaagtaa

DBGET integrated database retrieval system