KEGG   Prevotella ruminicola: PRU_0658Help
Entry
PRU_0658          CDS       T01212                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
pru  Prevotella ruminicola
Pathway
pru00220  Arginine biosynthesis
pru00250  Alanine, aspartate and glutamate metabolism
pru00471  D-Glutamine and D-glutamate metabolism
pru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PRU_0658
   00220 Arginine biosynthesis
    PRU_0658
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PRU_0658
Enzymes [BR:pru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PRU_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF4479
Motif
Other DBs
NCBI-ProteinID: ADE81611
UniProt: D5EYH2
Position
772754..773668
Genome map
AA seq 304 aa AA seqDB search
MDYGQIIDKVYTACLPFANEGRQADYIPMLAEVDAKQFGLCLLTLDGNVYEQGNTRTRFS
LQSISKVFALAMCLSQEADRLWQRMGKEPSGNAFNSLVQLEYEHGIPRNPFINAGAIVMA
DVLLSTLSRPEEQFLTFVRSLSGSSTVGFNRRVAQSEQSCGYLNAAIANLLKYHGNIRGD
ITRVLEFYFLMCSVEMSCHELAHAFLPFANHRQPFNYGGVSLTSSQVKRINAIMQTCGFY
DEAGEFSYRVGLPGKSGVGGGIAAIHPLHYAVATWSPRLNIKGNSVMGMKALELLTSETE
ESIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactacggacagattatagataaggtgtacacagcctgcctgcccttcgccaatgaa
gggaggcaggctgactatattcccatgctggcagaagtagatgccaaacagtttggcctg
tgcctgctgacgctcgacgggaatgtctacgagcaaggcaacacgcgcacccgcttctcg
ctgcagagcatcagcaaggtgtttgccctagccatgtgcctcagccaggaggctgaccgc
ctgtggcagcgcatgggtaaggagccttccggtaatgcgttcaattcgctggtacagctg
gaatatgaacacggcattccccgcaatccgttcatcaacgccggtgctatcgtcatggcc
gacgtgctgctctctacgctgagccgccccgaggaacaatttctgacctttgtcaggagc
ctcagtggcagcagcaccgtggggttcaaccgccgtgtggcacagagtgaacaaagttgc
ggctacctgaacgcagccattgccaacctgctgaaataccacggcaacattcggggtgac
attacccgtgtactagaattctacttcctgatgtgctccgtagagatgtcgtgccacgag
ttggcccacgccttcctgccctttgccaaccatcggcaaccattcaactatggcggcgtg
tcgctcacctcgtcgcaggtgaaacgcataaatgccatcatgcagacctgcggattctat
gacgaagccggagaattctcttatcgcgtaggcttgccgggcaagagcggcgtgggaggc
ggcatagcggccatccatccgctgcactatgccgtagccacctggagcccccggcttaac
ataaagggtaactccgtcatgggcatgaaggcactggaactgctgacctctgagaccgaa
gagtctatcttttaa

DBGET integrated database retrieval system