KEGG   Prevotella ruminicola: PRU_0846Help
Entry
PRU_0846          CDS       T01212                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pru  Prevotella ruminicola
Pathway
pru00900  Terpenoid backbone biosynthesis
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
pru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PRU_0846 (ispE)
Enzymes [BR:pru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PRU_0846 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADE82725
UniProt: D5EZA8
Position
990029..990862
Genome map
AA seq 277 aa AA seqDB search
MITFPIAKINLGLNVVEKRADGYHNLQTVFFPVPLLDALDVQEMGAEFPSQYDCDLKVSN
IHIDGDEQRNLVVRAYNLLKQDFPDMPRVHAHLYKGIPTQAGMGGGSSDCGFMITLLNKM
FNLGLSDEQMIQYAARLGADCAFFILNKPCYAEGIGEKLQPIQLSLSGWYLSLVRPDIPV
STREAFALIKPHYPEFNCKEVVQLPVEEWRGKLTNDFEDSVFAVHPELGAVKDRLYQLGA
TYAAMSGSGSTLFALSKQPLNLDEFAQEGTFITTISI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgataacatttcctatagcaaagatcaatctcggtctgaacgttgtcgagaagcgtgct
gatggttatcacaacctgcagacggtgttcttccccgtgcccctgctcgatgcgctcgat
gtgcaggagatgggcgccgagttcccctcgcagtatgattgcgacctgaaggtgtcgaac
atccatatcgatggcgacgagcagcgcaacctggtagttcgtgcctacaacctgttgaag
caggattttcctgatatgcctcgcgtgcacgcgcacctgtataaaggtatccccacgcag
gctggtatgggtggcggatcgagcgattgcggctttatgattacgctgcttaacaagatg
tttaacctagggctgagcgatgagcagatgatacagtatgccgcccgtctgggtgccgac
tgcgccttctttatcctcaacaagccttgctatgccgagggtatcggcgaaaaactgcag
cccatacagctctcattatcaggctggtatctctcgttggttcgaccagacattccggtt
tctacccgcgaggccttcgcgctcataaaaccccactaccccgagtttaactgtaaagag
gtagtacagttgcccgttgaagagtggcgtggcaaactaactaacgatttcgaggacagc
gtgtttgctgtgcatcccgagttaggtgccgttaaggatcgcctgtatcagctgggtgcc
acctatgctgccatgtcgggttcgggctctaccctgtttgccctgtcaaagcagccgctt
aatctcgatgagttcgctcaagagggaacatttattacaactatatcaatataa

DBGET integrated database retrieval system