KEGG   Prevotella ruminicola: PRU_0897Help
Entry
PRU_0897          CDS       T01212                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pru  Prevotella ruminicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PRU_0897 (recR)
DNA repair and recombination proteins [BR:pru03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PRU_0897 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048934..1049551)
Genome map
AA seq 205 aa AA seqDB search
MIQQQYPSQLLEKAVQEFSKLPGIGRKTALRLVLWMLRQDDSDVTQFTAAVNELKCGVKY
CKVCHNISDTDICPICADQRRDQTTVCVVENIQDVMAIENTQQFNGLYHVLGGVISPMDG
MGPADIEIDSLIQRVGEGTVQEVILALSPTMEGDTTNFYIYRKLAPTGIKVSVIARGIAV
GNELEYADEVTLGRSITNRTLFEEK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatacaacaacaatacccatcgcaactgctcgaaaaggctgtacaggagttttcgaag
ctaccgggcatcggcaggaaaaccgccctgcgcctggtactctggatgctgcgtcaggac
gatagcgacgtaacacagtttactgcggcagtaaacgagctgaagtgcggcgtaaagtac
tgtaaagtgtgccacaatatcagcgataccgacatctgtcccatctgtgccgaccagcgc
cgcgaccaaacaacggtgtgcgtggttgagaacatacaggatgtgatggccatcgagaac
acccaacagttcaatggtctgtaccacgtattaggtggtgtgatatcgcccatggacggc
atgggtcctgccgacatcgagatcgactcactgatacagcgcgtaggcgagggcacggta
caggaggtgatattagccctgagtccaactatggaaggcgacaccaccaacttctacatc
taccgaaaactggcgcctactggcataaaagtaagcgtgatagcccgaggcatagccgtg
ggcaacgaactggagtatgccgacgaggttacgctgggccgatcgattactaaccgaaca
ttgtttgaagaaaaatag

DBGET integrated database retrieval system