KEGG   Prevotella ruminicola: PRU_1018Help
Entry
PRU_1018          CDS       T01212                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pru  Prevotella ruminicola
Pathway
pru00260  Glycine, serine and threonine metabolism
pru00750  Vitamin B6 metabolism
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
pru01120  Microbial metabolism in diverse environments
pru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PRU_1018 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PRU_1018 (thrC)
Enzymes [BR:pru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PRU_1018 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADE81829
UniProt: D5ERU6
Position
1188440..1189762
Genome map
AA seq 440 aa AA seqDB search
MKYYSTNGKAPIADLHKAVVKGLAEDRGLYMPERINKLPQEFFDNIEKMSFQEIAYTVAS
AFFGEDVDPDALHDIVYDTLAFDCPVVNVKDNIYTLELFHGPTLAFKDVGARFMARLLQY
FIKQESGHKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSPIQECQFTTLGKN
ITAIEVDGVFDDCQALVKNAFMDAELNEHMKLTSANSINVARFLPQAFYYFNAYARMKEN
AKIEKCNNVNNLVMCVPSGNFGNICAALFGHEMGLPIKRFIAANNANDIFYKYLQTGKYE
PKPSKQTLANAMDVGDPSNFARIYDLYDKSHEKISALISGATYSDEQIRETMRECYKASG
YILDPHGACGYQALADGLQAGEVGVFCETAHPAKFKEKVDEILGIDVEIPERLAAFMRGE
KQSVAMSKDFADFKDYLMHQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactatagcaccaacggcaaggctcctattgccgacctgcacaaagcagtagtt
aagggactggctgaggatcgcggactgtatatgcccgagcgtatcaacaagttgccccag
gagtttttcgacaacatcgagaaaatgagttttcaggagattgcctacaccgtagccagc
gctttctttggcgaggatgtagatcctgatgccctgcatgatattgtgtacgacaccttg
gcattcgattgcccagtggtgaacgtaaaagacaatatttacaccttggagttgttccac
ggtcctaccctcgcctttaaggatgtgggtgcccgttttatggcgcgcttgctgcagtac
ttcatcaagcaggagtcaggtcataagcaggtgaacgtgctggttgctaccagcggcgat
accggttcggctgtggccaacggattcttgggtgttgagggtatccacgtgtacgtgctg
tatcccaagggcaaggtaagtcctatccaggagtgccagtttaccacactgggtaagaac
atcaccgctatcgaggtggatggtgtgttcgacgattgtcaggcgctggtaaagaatgcc
tttatggatgccgaactgaacgagcacatgaagctgacatcggccaactcaatcaacgtg
gcccgttttctgccccaggcattctactactttaatgcctacgcccgcatgaaagaaaat
gcaaaaattgaaaaatgtaataatgtaaataatctggtgatgtgcgtgccatcaggaaac
ttcggaaatatctgtgcagcgctgttcggccatgagatgggactgcccatcaagcgattc
atcgcagccaacaatgccaacgatatcttctacaagtatctgcagactggcaaatacgag
cctaagccatcgaagcagactctggctaatgcgatggacgtaggcgatccttcgaacttt
gcccgtatctacgacctgtacgataagagtcacgagaagattagcgcgctgattagcggt
gctacctatagcgacgagcagattcgcgaaaccatgcgcgagtgctacaaagcttcgggt
tatatcctggatcctcatggtgcttgcggctatcaggctttggccgacggactgcaggct
ggcgaggttggtgtgttctgcgaaacagcccacccagctaagtttaaggagaaggtggat
gagattctgggcatcgacgtagaaatacctgagcgcttggctgcctttatgcgtggcgaa
aagcaaagcgtggccatgagtaaggactttgcagactttaaagattatctcatgcatcaa
taa

DBGET integrated database retrieval system