KEGG   Prevotella ruminicola: PRU_1018Help
Entry
PRU_1018          CDS       T01212                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pru  Prevotella ruminicola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PRU_1018 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PRU_1018 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PRU_1018 (thrC)
Enzymes [BR:pru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PRU_1018 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188440..1189762
Genome map
AA seq 440 aa AA seqDB search
MKYYSTNGKAPIADLHKAVVKGLAEDRGLYMPERINKLPQEFFDNIEKMSFQEIAYTVAS
AFFGEDVDPDALHDIVYDTLAFDCPVVNVKDNIYTLELFHGPTLAFKDVGARFMARLLQY
FIKQESGHKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSPIQECQFTTLGKN
ITAIEVDGVFDDCQALVKNAFMDAELNEHMKLTSANSINVARFLPQAFYYFNAYARMKEN
AKIEKCNNVNNLVMCVPSGNFGNICAALFGHEMGLPIKRFIAANNANDIFYKYLQTGKYE
PKPSKQTLANAMDVGDPSNFARIYDLYDKSHEKISALISGATYSDEQIRETMRECYKASG
YILDPHGACGYQALADGLQAGEVGVFCETAHPAKFKEKVDEILGIDVEIPERLAAFMRGE
KQSVAMSKDFADFKDYLMHQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactatagcaccaacggcaaggctcctattgccgacctgcacaaagcagtagtt
aagggactggctgaggatcgcggactgtatatgcccgagcgtatcaacaagttgccccag
gagtttttcgacaacatcgagaaaatgagttttcaggagattgcctacaccgtagccagc
gctttctttggcgaggatgtagatcctgatgccctgcatgatattgtgtacgacaccttg
gcattcgattgcccagtggtgaacgtaaaagacaatatttacaccttggagttgttccac
ggtcctaccctcgcctttaaggatgtgggtgcccgttttatggcgcgcttgctgcagtac
ttcatcaagcaggagtcaggtcataagcaggtgaacgtgctggttgctaccagcggcgat
accggttcggctgtggccaacggattcttgggtgttgagggtatccacgtgtacgtgctg
tatcccaagggcaaggtaagtcctatccaggagtgccagtttaccacactgggtaagaac
atcaccgctatcgaggtggatggtgtgttcgacgattgtcaggcgctggtaaagaatgcc
tttatggatgccgaactgaacgagcacatgaagctgacatcggccaactcaatcaacgtg
gcccgttttctgccccaggcattctactactttaatgcctacgcccgcatgaaagaaaat
gcaaaaattgaaaaatgtaataatgtaaataatctggtgatgtgcgtgccatcaggaaac
ttcggaaatatctgtgcagcgctgttcggccatgagatgggactgcccatcaagcgattc
atcgcagccaacaatgccaacgatatcttctacaagtatctgcagactggcaaatacgag
cctaagccatcgaagcagactctggctaatgcgatggacgtaggcgatccttcgaacttt
gcccgtatctacgacctgtacgataagagtcacgagaagattagcgcgctgattagcggt
gctacctatagcgacgagcagattcgcgaaaccatgcgcgagtgctacaaagcttcgggt
tatatcctggatcctcatggtgcttgcggctatcaggctttggccgacggactgcaggct
ggcgaggttggtgtgttctgcgaaacagcccacccagctaagtttaaggagaaggtggat
gagattctgggcatcgacgtagaaatacctgagcgcttggctgcctttatgcgtggcgaa
aagcaaagcgtggccatgagtaaggactttgcagactttaaagattatctcatgcatcaa
taa

DBGET integrated database retrieval system