KEGG   Prevotella ruminicola: PRU_1079Help
Entry
PRU_1079          CDS       T01212                                 

Definition
family 2 glycosyl hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pru  Prevotella ruminicola
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pru00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pru00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pru00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263183..1265636
Genome map
AA seq 817 aa AA seqDB search
MKKGLITMLLAAPLSVFAQQRQEITLSDNWLFSQNKSDWQTVCVPHDWAIAGPFDKKWDL
QKVAIEQNGETEATEKSGRSGALPWIGEGHYKRTITIPEGYKHAMLVFDGAMSEPTVSIN
GMQAGYWAYGYNTFRVNITPFIQTGDNLLEVDLQNVEESSRWYPGAGIYRPVKLVLTKYG
WIDPWKTYIRTRELSANLAVLDVNVGIGSALDGGLKFDVEICDATGKVVASGSSDDLNNE
GIAQMAITVNQPQLWSPESPYLYTARIKYSQSGELLDEVTQKFGIRTIKCSKDGGFQLNG
VSRKIKGVCLHHDLGPLGAAINKSALIRQIKMMKAMGCDAIRTSHNMPSQMQMDVCDSLG
MMVMAESFDMWKYPKCKNGYARFFDEWWAKDITNLVLANRNHPSIIMWSIGNEIPEQGNK
VEGPKMAKALQDLCHQLDPSRPVTQGMDRVDEAVNYGFAAVMDVPGYNYRLPKYKLYYEK
LPQGFLLGSETASTVSSRGVYKFPVEIKDNSQYASWSPGYIPGAVLKEDGQCSAYDVEHC
SWSNLPDDDWVMQDDLPWVIGEFVWTGYDYLGEPTPYDEYWPSRSSYFGICDLAGLPKDR
YFLYRSKWNKDQHTIHLLPHWSFGKERVGKVTPVYCYTDYPAGELFVNGKSQGKVTKNPA
ERLDRYRLRWNNVVYKPGEVKVVVYDTQGNKAGEQTIRTAGKPSAIACDVWTQHDAPCLK
ADGDDLAFVTVSLTDKNGIMIPEADDQLTFEVTGAGTFEAVCNGDATSLEPFKEPTMKLF
KGQLVVIVRGAKQPGTAILKVTDKSRKLSKTIEIKVG
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggactaattacaatgctgttggcagccccgttatcggtgtttgcccaacag
cgacaggaaatcacattgagtgataactggctcttctcacaaaacaaatctgattggcaa
accgtttgtgtgcctcacgattgggctattgcaggaccgtttgataagaaatgggacttg
cagaaggtggctatcgaacagaatggcgaaaccgaagcaaccgaaaagagtggacgttcg
ggtgccctgccctggattggcgaaggacattataagcgaaccatcactatcccagaaggt
tacaagcatgcaatgctggtgttcgatggggctatgtccgaacctacagtaagcatcaac
ggcatgcaggccggctattgggcctacggctacaataccttccgcgtgaatatcacccca
tttatacaaacaggcgacaacctgctggaggttgatctgcagaatgtagaagagagcagt
cgctggtatcctggcgctggtatctaccgtcctgtaaaactggtacttacaaaatacgga
tggattgatccttggaaaacttatatccgcacccgcgaactgagtgccaacctggctgta
cttgatgtaaacgtgggtatcggcagtgcgctggatggtggtttaaaattcgatgtggag
atttgcgatgctactggtaaagtagtagcaagcggcagtagtgacgacctgaacaacgaa
ggcattgcacaaatggctataaccgttaatcagccccagctgtggagccctgagtcacct
tatttatatactgctcgcatcaaatactcgcagagtggcgaactgcttgatgaagtaaca
cagaagtttggtatccgtaccatcaaatgctcaaaggatggtggtttccagcttaatggc
gtatcgcgcaaaattaagggtgtttgcttgcatcacgaccttggtccgttgggtgccgcc
atcaacaagagtgcacttatccgacagatcaagatgatgaaggcgatgggttgtgatgca
attcgtacatcgcacaatatgcccagtcagatgcagatggatgtttgcgattcgttgggt
atgatggtgatggccgagagcttcgacatgtggaaatatcccaagtgcaagaatggttat
gcacgtttcttcgatgagtggtgggcgaaggatatcaccaacctggtgcttgccaaccgt
aatcatcccagcatcatcatgtggagtatcggcaacgagattcctgaacaaggcaataaa
gtcgaaggtccgaagatggccaaggccctgcaggatctctgtcatcagctcgacccctca
cgtcccgttacacaaggtatggaccgtgtagatgaagccgtaaactatggttttgctgct
gtcatggatgttccaggttacaactaccgactgcctaaatataaactgtattacgaaaag
ctgccacagggattcctgttaggttccgaaacggcttcaaccgtcagcagtcgcggcgta
tataagttccctgtcgagattaaggacaactcgcagtatgcctcatggtcgcctggttat
attcctggtgccgtactgaaagaagacggacagtgttcggcttatgatgtggagcattgc
tcgtggagtaatctgcccgacgacgattgggtgatgcaggacgatctgccttgggtgatt
ggtgagtttgtttggacaggttacgactatctgggtgagcctaccccatacgatgagtac
tggccctcgcgcagcagctatttcggcatctgcgatttggccggtctgcctaaggatcgt
tatttcctgtatcgttctaagtggaacaaggatcagcatactatccatctgctgcctcac
tggagctttggcaaggaacgtgttggcaaggtaacaccagtttattgctacaccgattat
cctgcaggcgaactctttgtaaatggtaagagtcagggtaaggtaactaagaatccagcc
gagcgtttggaccgttatcgtctgcgttggaacaatgtggtttacaagccaggcgaggta
aaagtggtggtttacgacacccaaggcaacaaggctggcgagcagaccatccgtacagca
ggcaaaccatcagccatcgcttgtgatgtttggacacagcacgatgccccatgtctgaag
gctgatggcgacgatttagccttcgttactgtatcacttactgataagaatggcatcatg
attccagaggccgacgatcagcttacttttgaggtgactggtgcaggtaccttcgaggct
gtctgcaatggcgatgccaccagcttagagccatttaaagagccaaccatgaagctgttt
aaaggtcagttggtagttattgttcgtggtgctaaacagccaggaacagccatcttgaag
gtaaccgataagagcagaaaactgagtaagactatcgagattaaagtaggctaa

DBGET integrated database retrieval system