KEGG   Prevotella ruminicola: PRU_1156Help
Entry
PRU_1156          CDS       T01212                                 

Definition
family 20 glycosyl hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pru  Prevotella ruminicola
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PRU_1156
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PRU_1156
Enzymes [BR:pru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PRU_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1361425..1363047
Genome map
AA seq 540 aa AA seqDB search
MKFKGMVLTALISLGSMTAAAGEPANYNVVPLPQSIVITKGAAFEVDADVQILAPAELQS
EAEFLKQYIKELTKCDLTIVNKRAKKVRYIELAVSPKVTAKEGYVLNINQKGVTIQGGTA
AGVFYGIQTLRKSLPIACKCGKHKGGCLPAATITDAPRFGYRGMMLDCSRHFWSVDFVKK
FIDLLAMHNMNTFHWHLSDDQGWRIEIKKYPKLTTIGSQRSGTILGTNSDLDDGIPHGGF
YTQQEARDIVKYAQERHITIIPEIDMPGHMLAALACYPELGCTGGPYEVGHYWGVYTDVL
CVGNPKVYEFVEGVLAEIMDIFPSEVIHIGGDETPTVKWEACPKCQALGQSKDKLQAHFT
QKVFGYLTAHQRRALGWDEILDGCPQDAMIMSWRGSEPGAKAAELGHDVVMTPTSHVYFD
YLQSKEAQFEPSRCGGFIPVEKVYSLEPAPDTLSVEAKKHILGTQANLWAEYLLTEGLVE
YQALPRMSALSEVQWTQPELKNYDAFKERLTRFTKLFEFYNYKYAKHLWPERQLPSRWQF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaaaggaatggtgttaacagcactcatctcgttaggctcaatgacagctgcg
gctggcgagcctgccaactacaacgtggtaccactgccacagtcgattgtgataacaaaa
ggtgcagcctttgaggttgacgccgacgtacagattctggctcctgccgaactgcagagc
gaagcagaattcctgaagcagtacatcaaagagctgaccaagtgcgacctgaccatcgtg
aacaagcgtgctaagaaggtgcgctacatcgagctggccgtatcgccaaaggtaaccgct
aaggaaggttatgtattgaacatcaaccagaagggtgttaccatccagggtggcacagca
gctggtgtgttctatggtatccagaccctgcgcaaatcgctgcctatcgcctgcaagtgc
ggtaagcacaagggtggctgtctgcctgccgcaacgattaccgatgccccacgctttggt
tatcgcggtatgatgctggattgctcacgccacttctggagcgtggatttcgtaaagaag
ttcatcgacctgctggctatgcacaacatgaacaccttccactggcatctgagcgacgac
cagggttggcgtatcgagatcaagaagtatcctaagcttaccactatcggttcgcagcgt
tcgggtactattctcggcaccaactctgatttggacgatggtatcccccacggtggtttc
tacacccagcaggaggctcgcgacattgtgaaatatgcccaggagcgccatatcactatc
atccctgagattgacatgcccggacacatgctggctgcactggcttgctatcccgaactg
ggttgcacaggcggtccttacgaggtaggtcactactggggtgtttacaccgatgtgctg
tgcgtaggcaatcctaaggtttacgagtttgtagagggtgtgctggccgagattatggac
atcttcccttcggaagtaatccatatcggtggcgacgaaactccaacagtaaaatgggag
gcgtgtcctaagtgtcaggccctcggacagagcaaggataagctgcaggctcactttaca
cagaaggtattcggctacctgacagcccatcagcgccgtgccctgggatgggacgagatt
ctggatggctgtccacaggatgccatgattatgtcgtggcgtggtagcgagccaggtgca
aaggctgccgagttaggtcacgacgtggtgatgacgcctacatcgcatgtttacttcgac
tatctgcagtcgaaggaggctcagttcgagccaagccgttgcggtggtttcattcctgta
gagaaggtatattcgctggagcctgctcccgacaccctgtcagtcgaagctaagaagcac
atcttgggtacacaggccaacctgtgggctgagtatctgctgaccgaaggactggtggaa
tatcaggccctgccacgtatgtcggctctgtcggaggtacagtggacacagcctgagctg
aagaactacgacgcctttaaggagcgcttgacacgattcacaaagctgttcgagttctac
aactacaaatatgccaagcatctgtggcctgagcgtcagttgcccagtcgctggcagttc
taa

DBGET integrated database retrieval system