KEGG   Prevotella ruminicola: PRU_1201Help
Entry
PRU_1201          CDS       T01212                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pru  Prevotella ruminicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PRU_1201 (pfkA)
   01230 Biosynthesis of amino acids
    PRU_1201 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_1201 (pfkA)
   00030 Pentose phosphate pathway
    PRU_1201 (pfkA)
   00051 Fructose and mannose metabolism
    PRU_1201 (pfkA)
   00052 Galactose metabolism
    PRU_1201 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PRU_1201 (pfkA)
Enzymes [BR:pru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PRU_1201 (pfkA)
Protein phosphatases and associated proteins [BR:pru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PRU_1201 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1420020..1420997)
Genome map
AA seq 325 aa AA seqDB search
MTKIKTIGILTSGGDAPGMNAAIRAVTRAGIYNGFRIKGIYRGYEGLIHDEVQEFTTENV
SGIVTRGGTILKTARSKEFPTPEGMQKAYETCVKEEIDALVVIGGNGSLTGARNFGMEFD
FPVIGLPGTIDNDLYGTDSTIGYDTTMNTIMECVDRIRDTANSHERIFFVEVMGRDAGFL
AQNSAIACGAEAAIVPEESTDVDQLAQFMSRGIRKSKKSCIVIVSESPKCGALYYADRVK
KEFPEFDVRVSILGHLQRGGTPSARDRILAATTGVGAIEAIKQGQRNVMVGIRNNEVVYV
PFSECIRTDKRFDKRLIKVLDELSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagattaagacaattggtatcctgacgtcgggaggcgatgcaccaggaatgaat
gccgctatacgtgctgtgacacgtgccggtatctacaacggttttaggattaaaggtata
tatcgtggttacgaaggactgattcatgatgaggttcaggagtttaccaccgaaaatgta
agtggaattgtgacacgtggcggtactatcctgaagactgcccgctcaaaggagttccca
actcccgagggcatgcagaaggcttacgagacttgtgtaaaggaagagattgatgcgctg
gtagttatcggtggtaacggatcgcttactggtgcccgtaacttcggtatggagttcgat
ttccctgtaatcggtctgcctggtacgattgataacgatttgtatggcaccgattctact
atcggttatgatacaaccatgaataccatcatggagtgtgtcgatcgtatccgtgataca
gccaactcgcatgagcgtatcttctttgtcgaggtgatggggcgtgatgccggattcctg
gcacagaactcggccattgcatgtggtgctgaggctgctatcgtacccgaggagagtacc
gatgtcgaccagctggcacagttcatgagtcgtggtatccgtaaatcaaagaagtcgtgt
atcgtgattgtgtcggagagtcctaagtgtggcgctctgtactatgccgaccgtgtaaaa
aaggagttccctgagtttgatgtacgtgtgtctatcctgggccatctgcagcgtggtggt
acaccatcagcgcgcgaccgcattctggctgctaccacaggtgttggtgctatcgaagcc
atcaaacagggacagcgcaacgtgatggttggtatccgcaataacgaggtggtttatgta
cctttcagcgagtgcatccgtactgataagcgtttcgacaagcgactgattaaggtactc
gacgagctcagcatttga

DBGET integrated database retrieval system