KEGG   Prevotella ruminicola: PRU_1279Help
Entry
PRU_1279          CDS       T01212                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pru  Prevotella ruminicola
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pru00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pru00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1523956..1524471
Genome map
AA seq 171 aa AA seqDB search
MINIIAAVAQDRAIGFQNKLIYWLPNDLKRFKALTTGHTIIMGRNTFLSLPKGALPNRRN
IVLSKSAFSSPFGEAGRGSFPGCDVYPSLDEALAHCAPDEDVYIIGGASVYQQALPLADR
LCLTEIDDTPAEADTFFPPYKDEWKEAARESHDIDDRHAHRYAFVDYIRKS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgattaacattattgcagctgttgctcaggatagagctatcggatttcagaacaagtta
atatattggttgccaaacgatcttaagcgcttcaaggcgctcactaccgggcataccatt
attatgggtcgcaacaccttcctgtcgctgcccaagggcgccctgcccaatcgtcgaaat
atagtgttaagtaaaagcgcattctcctccccctttggggaggccgggagaggctccttt
cctggttgcgatgtgtatccatcgttagacgaggccctggctcattgcgcccccgacgag
gatgtgtatatcatcggtggtgccagcgtttaccagcaggccctgcccctggccgatcgc
ctctgcttgacagaaatcgacgataccccagccgaggccgacaccttcttccctccctac
aaagatgagtggaaagaggccgcccgcgaatcacacgacatcgacgatcgccacgcccac
cgctacgccttcgtagattatattagaaaaagttga

DBGET integrated database retrieval system