KEGG   Prevotella ruminicola: PRU_1347Help
Entry
PRU_1347          CDS       T01212                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pru  Prevotella ruminicola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pru00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pru00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1597363..1597983
Genome map
AA seq 206 aa AA seqDB search
MVVAYAKAAFFFITTTRILLQHDMKTVYDFTVKDRKGKDVSLKEYANEVLLIVNTATKCG
FTPQYEELEKLYEQYHSQGFEILDFPCNQFGQQAPGTDESIHEFCKLNFGTEFPRFKKIK
VNGDDADPLYKFLQEQKGFAGWDMSHKIAPILDDMLSKEDPDYKQKADIKWNFTKFLINK
KGQVVARFEPTENIENIAKQIEELLK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtagttgcatatgccaaggccgcatttttttttattacaacaacccgaatattatta
caacacgatatgaaaacagtttatgacttcactgtcaaggacagaaaaggaaaagacgta
tctctgaaagaatacgccaacgaggtgttgctgattgtaaacacagcaactaagtgtgga
ttcacgccacagtacgaggaactggagaaactctatgagcagtaccacagtcagggtttc
gagattctcgacttcccctgcaaccagttcggacagcaggcacctggtaccgatgagagt
atccacgagttctgcaagctgaactttggtactgagttcccacgctttaagaagattaag
gtaaatggcgacgacgccgatcctctgtataagttccttcaggagcagaaaggctttgcc
ggttgggatatgagccacaagattgcccctatcctcgacgacatgctctcgaaagaggat
cctgactacaagcagaaagctgatattaagtggaatttcacaaagttcctgattaacaag
aagggacaggttgttgctcgttttgagcctactgagaatattgagaatattgccaagcag
attgaagagctgcttaagtaa

DBGET integrated database retrieval system