KEGG   Prevotella ruminicola: PRU_1347Help
Entry
PRU_1347          CDS       T01212                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pru  Prevotella ruminicola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PRU_1347
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PRU_1347
Enzymes [BR:pru01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PRU_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1597363..1597983
Genome map
AA seq 206 aa AA seqDB search
MVVAYAKAAFFFITTTRILLQHDMKTVYDFTVKDRKGKDVSLKEYANEVLLIVNTATKCG
FTPQYEELEKLYEQYHSQGFEILDFPCNQFGQQAPGTDESIHEFCKLNFGTEFPRFKKIK
VNGDDADPLYKFLQEQKGFAGWDMSHKIAPILDDMLSKEDPDYKQKADIKWNFTKFLINK
KGQVVARFEPTENIENIAKQIEELLK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtagttgcatatgccaaggccgcatttttttttattacaacaacccgaatattatta
caacacgatatgaaaacagtttatgacttcactgtcaaggacagaaaaggaaaagacgta
tctctgaaagaatacgccaacgaggtgttgctgattgtaaacacagcaactaagtgtgga
ttcacgccacagtacgaggaactggagaaactctatgagcagtaccacagtcagggtttc
gagattctcgacttcccctgcaaccagttcggacagcaggcacctggtaccgatgagagt
atccacgagttctgcaagctgaactttggtactgagttcccacgctttaagaagattaag
gtaaatggcgacgacgccgatcctctgtataagttccttcaggagcagaaaggctttgcc
ggttgggatatgagccacaagattgcccctatcctcgacgacatgctctcgaaagaggat
cctgactacaagcagaaagctgatattaagtggaatttcacaaagttcctgattaacaag
aagggacaggttgttgctcgttttgagcctactgagaatattgagaatattgccaagcag
attgaagagctgcttaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system