KEGG   Prevotella ruminicola: PRU_1351Help
Entry
PRU_1351          CDS       T01212                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pru  Prevotella ruminicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pru01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pru00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pru00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602444..1603805
Genome map
AA seq 453 aa AA seqDB search
MSKQKKFILQESEIPTQWYNIQADMPTKPMPPIHPATKQPLGVDDLAHIFPRECCVQELD
TEHRWIDIPEEVLEKYKFYRSTPLVRAYALEEALGTPAHIYFKNESTNPLGSHKINSAIP
QCYYAKQEGTTNVTTETGAGQWGAALSYAAKIYGLDCAVYQVKITMQQKPYRSSIMRTFG
AVVEGSPSMSTRAGKDILTKDPTHSGSLGTAISEAVELATTTPNCKYTLGSVLNHVGLHQ
TIIGLEAEKQMEMAGEYPDIVIACFGGGSNFGGIAFPFMRHNLCDGKKTEFIAAEPDSCP
KLTRGQFRYDFGDEAGYTPLLPMFTLGHNFKPSNIHAGGLRYHGAGMIVSQLLKDGLMRG
VDIPQLETFEAGMLFARTEGIIPAPESCHAIAATIREAKKCKETGEEKVILFNLSGHGLI
DMPSYDSFIKGDLQNYTVTDEMIAANLAELDKQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaaaaaaattcatcctccaagagagtgagattcccacacagtggtacaac
attcaggctgacatgccaaccaaaccaatgcctcccatccatcctgcaaccaagcagcct
ctgggtgtagacgatctggcacacatcttccctcgtgagtgctgtgtacaggagcttgat
acagagcatcgctggatagatattccagaagaggtgctcgagaagtacaagttctatcgt
tcaactccattggttcgtgcctatgcgctcgaggaggctttgggaacacctgcccatatc
tactttaaaaacgagagtaccaacccattgggttcacataaaatcaactctgccattcct
cagtgctactacgccaagcaggaaggcaccactaacgtaaccaccgaaaccggtgccgga
cagtggggagcagccctttcatacgctgcaaaaatctacggtctcgactgcgctgtttat
caggtaaagattaccatgcagcagaagccataccgctcaagcattatgcgtacctttggt
gctgtggtcgagggttcaccttcgatgtcaacccgcgccggtaaggacatcctcactaag
gatcctacccattcaggttcattaggtacagccatctctgaggctgttgagctggctact
accactccaaactgtaagtacaccttaggttcggtattaaaccacgtaggtttgcatcag
accatcatcggtcttgaggccgagaagcagatggagatggctggcgagtatcctgatatc
gtgattgcttgctttggtggaggttctaacttcggtggtatcgccttcccattcatgcgc
cacaacctgtgcgatggcaagaagaccgagtttatcgctgccgagcccgacagctgtcct
aagctcacacgtggtcagttccgctacgactttggcgacgaggctggttacaccccattg
ctgcctatgttcacactgggtcataacttcaagccaagcaacatccacgctggtggtctg
cgttatcatggtgctggtatgattgtaagtcagctgttgaaggacggactgatgcgtggt
gttgatatcccacagcttgagaccttcgaggctggtatgctatttgcacgcaccgagggt
atcatccctgctcctgagagctgtcacgctattgcagccaccatccgcgaggctaagaag
tgcaaggaaactggcgaggagaaggtgattctcttcaacctctcaggtcatggtctgatt
gatatgccaagctacgactcattcatcaagggcgacctgcagaactacaccgttactgat
gagatgattgccgctaacctggccgaactggataagcagtaa

DBGET integrated database retrieval system