KEGG   Prevotella ruminicola: PRU_1351Help
Entry
PRU_1351          CDS       T01212                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pru  Prevotella ruminicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PRU_1351
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PRU_1351
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PRU_1351
Enzymes [BR:pru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PRU_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1602444..1603805
Genome map
AA seq 453 aa AA seqDB search
MSKQKKFILQESEIPTQWYNIQADMPTKPMPPIHPATKQPLGVDDLAHIFPRECCVQELD
TEHRWIDIPEEVLEKYKFYRSTPLVRAYALEEALGTPAHIYFKNESTNPLGSHKINSAIP
QCYYAKQEGTTNVTTETGAGQWGAALSYAAKIYGLDCAVYQVKITMQQKPYRSSIMRTFG
AVVEGSPSMSTRAGKDILTKDPTHSGSLGTAISEAVELATTTPNCKYTLGSVLNHVGLHQ
TIIGLEAEKQMEMAGEYPDIVIACFGGGSNFGGIAFPFMRHNLCDGKKTEFIAAEPDSCP
KLTRGQFRYDFGDEAGYTPLLPMFTLGHNFKPSNIHAGGLRYHGAGMIVSQLLKDGLMRG
VDIPQLETFEAGMLFARTEGIIPAPESCHAIAATIREAKKCKETGEEKVILFNLSGHGLI
DMPSYDSFIKGDLQNYTVTDEMIAANLAELDKQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaaaaaaattcatcctccaagagagtgagattcccacacagtggtacaac
attcaggctgacatgccaaccaaaccaatgcctcccatccatcctgcaaccaagcagcct
ctgggtgtagacgatctggcacacatcttccctcgtgagtgctgtgtacaggagcttgat
acagagcatcgctggatagatattccagaagaggtgctcgagaagtacaagttctatcgt
tcaactccattggttcgtgcctatgcgctcgaggaggctttgggaacacctgcccatatc
tactttaaaaacgagagtaccaacccattgggttcacataaaatcaactctgccattcct
cagtgctactacgccaagcaggaaggcaccactaacgtaaccaccgaaaccggtgccgga
cagtggggagcagccctttcatacgctgcaaaaatctacggtctcgactgcgctgtttat
caggtaaagattaccatgcagcagaagccataccgctcaagcattatgcgtacctttggt
gctgtggtcgagggttcaccttcgatgtcaacccgcgccggtaaggacatcctcactaag
gatcctacccattcaggttcattaggtacagccatctctgaggctgttgagctggctact
accactccaaactgtaagtacaccttaggttcggtattaaaccacgtaggtttgcatcag
accatcatcggtcttgaggccgagaagcagatggagatggctggcgagtatcctgatatc
gtgattgcttgctttggtggaggttctaacttcggtggtatcgccttcccattcatgcgc
cacaacctgtgcgatggcaagaagaccgagtttatcgctgccgagcccgacagctgtcct
aagctcacacgtggtcagttccgctacgactttggcgacgaggctggttacaccccattg
ctgcctatgttcacactgggtcataacttcaagccaagcaacatccacgctggtggtctg
cgttatcatggtgctggtatgattgtaagtcagctgttgaaggacggactgatgcgtggt
gttgatatcccacagcttgagaccttcgaggctggtatgctatttgcacgcaccgagggt
atcatccctgctcctgagagctgtcacgctattgcagccaccatccgcgaggctaagaag
tgcaaggaaactggcgaggagaaggtgattctcttcaacctctcaggtcatggtctgatt
gatatgccaagctacgactcattcatcaagggcgacctgcagaactacaccgttactgat
gagatgattgccgctaacctggccgaactggataagcagtaa

DBGET integrated database retrieval system