KEGG   Prevotella ruminicola: PRU_1454Help
Entry
PRU_1454          CDS       T01212                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pru  Prevotella ruminicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PRU_1454 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PRU_1454 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PRU_1454 (trpB)
Enzymes [BR:pru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PRU_1454 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1736388..1737593
Genome map
AA seq 401 aa AA seqDB search
MENYFADERGFYGEFGGAYVPEILYKCVHDLQEAYLPIIESAEFKAEYHALLKDYVGRPS
PLYFAKRMSEKYGCQLYLKREDLNHTGAHKINNTIGQILLAKKLGKTRIIAETGAGQHGV
ATATVCALMNMKCEVFMGATDVERQHTNVERMKMLGAEVHPVRTGNMTLSDACSEAIRDW
CCHPADTFYIVGSTMGPHPYPDLVARMQSVISEEIKWQLEAQIGRDYPDYLIACIGGGSN
AAGTIYHYVNEERTKIVLAEAGGHGWQTDHTAATIHKGTTGILHGSKMLVMQDENGQIQE
AFTISAGLDYPGVGPMHCNMAKKGRTQVLSINDDEAIRGGYELTRMEGIIPAIESAHAIA
ALSKLTFKKDDVVVLTVSGRGDKDVETYLKNKAMAGEYGYF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattattttgctgacgagagaggtttttacggagagtttggcggggcgtatgtt
cccgagatactctacaagtgtgtacacgacctgcaggaggcttacctgcctatcattgaa
agcgcagagtttaaggcagaataccacgccctgctgaaagattatgttggtcgccccagt
ccactgtacttcgctaagcgcatgagcgagaagtatggttgccaactttacttgaagcgt
gaggacctgaaccatacgggtgcccacaagatcaacaacactatcggacagattctgctg
gccaagaaattgggcaagacacgcatcatagccgagacaggtgccggccagcacggtgtg
gccactgccaccgtgtgcgcactgatgaacatgaagtgcgaggtgtttatgggagctacc
gacgtggagcgccagcacaccaatgtggagcgcatgaagatgctgggtgccgaggttcac
cccgtacgtacaggtaacatgacgctgagcgatgcctgtagcgaggctatacgcgactgg
tgctgtcaccctgctgacactttctacatcgtaggtagcaccatgggcccacacccctac
cccgacctggtggcacgcatgcagagcgtgatcagcgaagaaatcaaatggcagctagag
gcccagattggtcgcgactatcccgactatctgatagcctgcatcggtggtggtagcaac
gcagccggcactatctatcactacgtgaacgaagagcgcaccaagattgtgctggccgaa
gctggcggacacggttggcagaccgaccatactgcagccaccatccataaaggtacaaca
ggtattcttcacggctcaaaaatgctggtgatgcaggatgagaacggacagatacaggag
gccttcaccatcagcgcaggtctggactatcccggcgttggtcccatgcactgcaacatg
gcgaagaaagggcgcacacaggtactgagtatcaacgacgatgaggctatccgtggcggt
tacgagctgacgcgtatggagggtatcatccccgccatcgaaagtgcccacgccattgca
gcactctcgaaactcacgttcaagaaggacgatgtagtagtgctgacggtaagcggtcgc
ggcgataaggacgtagagacctatctgaagaataaggctatggctggtgaatacggatat
ttttga

DBGET integrated database retrieval system