KEGG   Prevotella ruminicola: PRU_1458Help
Entry
PRU_1458          CDS       T01212                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pru  Prevotella ruminicola
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pru01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pru00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1740709..1741494
Genome map
AA seq 261 aa AA seqDB search
MDILEEIVANKRVEVEAAKLAVAPAVLHKQVEAILDFSVASMKNALTASDSGIIAEFKRK
SPSKGWIKEEGQPDIIPLSYQKNGAAALSILTDQKYFGGCDDFIRTARHSGVNIPILYKN
FVIDEYQLFQARLCGASAVLLIAADLSIAECKSLLNTAHQLGLEVLLEMHSNKELEYAGL
EPDMYGINNRNLGSFVTDVENSFRLAELLPKDAVKVSESGISNPDTVKALREVGFRGFLI
GENFMKTADPGSALRELIEKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatatattagaagagatagtagcgaacaagcgcgtggaagttgaagcagccaagttg
gctgtagcaccagcagtgctgcacaaacaggtggaggcgattctcgactttagcgtggct
tcgatgaaaaatgccctcaccgcatccgactcgggcatcatcgcagagttcaaacgcaag
tcaccttcaaagggttggatcaaagaggagggccaacccgacatcatcccattgagctac
caaaagaatggcgctgctgcactgagcatacttaccgaccagaagtattttggcggttgc
gacgactttattcgcacggcccgtcacagcggtgtaaacatccccatcctttacaagaac
tttgtgatagatgagtaccagctgttccaggcacgcttgtgcggggcttcggctgtactg
ctgattgccgccgacttgtcgatagccgagtgtaaaagtctgctgaacaccgcccaccag
ttaggtctggaagttcttttagagatgcactccaacaaagaattggaatacgctgggtta
gagccagatatgtacggtatcaacaaccgcaatttaggttcatttgtgaccgacgtagag
aactcattccgcttggctgagctattaccaaaggatgccgtaaaggtgagcgagagtggt
atttcgaaccctgatacggtgaaggctttacgtgaggttggtttccgtggtttcctgatt
ggcgagaactttatgaagacagccgatccaggatcagcattacgtgaattgattgagaag
ctatga

DBGET integrated database retrieval system