KEGG   Prevotella ruminicola: PRU_1737Help
Entry
PRU_1737          CDS       T01212                                 

Definition
(GenBank) peptidase, M42 (glutamyl aminopeptidase) family (EC:3.4.11.-)
Organism
pru  Prevotella ruminicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2094491..2095537
Genome map
AA seq 348 aa AA seqDB search
MQIDMESWLKDILHKMLLTASPSGSEEQITALFAEQLRPFVDEVTTDVNGNCIAHKQGTG
PKVMIMAHADEIGLMISYIDDRGFLYFKEIGGIDTNLLPGQRVNIMGQQGLVTGVIGKKP
IHLQDKSENTKQLEPEDLWIDIAAKDKSEAQSKVQIGDVATLQGNPVQLNDTLLMSRSLD
DKIGLAVLMGLAQNLQSLQTDKDIYLVASVQEELGARGAKMITEAIRPDIGIAIDVTHAT
DYPTMSPTKDGDISLGKGAVIPMGPNMSKGINQQLISLAKSNGIPYQIEAIARPTGTDAR
EIQVAGTGIRTGLISIPCRYMHTPSEVVSLADADSAITLLSAYLHTRE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattgatatggaatcatggttgaaagacatattgcacaagatgctactgacagca
agtccgtcaggcagcgaagagcaaatcacagcgctctttgctgagcagttacgtcccttt
gtagatgaagtaaccaccgacgtcaatggcaactgcattgcccacaaacagggcactggg
ccaaaagttatgatcatggcgcatgccgatgagattggcttaatgattagttacattgat
gatcgcggtttcctatatttcaaagaaattggcggtatcgacacaaatcttctccccggt
cagcgtgtaaatatcatggggcagcaaggccttgtaacaggcgttataggcaagaagccc
atacatcttcaggacaaatccgagaacaccaagcagctcgaaccagaagacctttggatc
gatattgccgccaaagataaatcagaagcacaatccaaggttcagattggtgatgtagcc
actctccaaggaaatcctgtacaacttaatgacacccttctcatgtcccgatcactagat
gacaaaatcggtttggcagtcttgatgggtctggcacagaatttgcagtccctgcaaaca
gataaggacatctatttagtggcctccgtacaggaagaattaggtgcacgcggtgcaaaa
atgataactgaggctatacgcccagatataggcattgccattgatgtaacccatgccact
gactatcccaccatgtcacccacaaaagatggtgacatcagcctaggcaaaggtgctgtc
atccctatggggcctaacatgagtaaaggtatcaaccagcagctcatcagcttggcaaaa
tccaatggcatcccctatcagatagaggccattgcccgccccacaggcaccgatgcccgc
gagatacaggttgccggcactggcatccgaacaggattgatcagcattccctgccgatat
atgcacaccccttcggaagttgtatcattggcagatgcagatagtgcaataaccctattg
tcggcttatttgcacactcgagaatag

DBGET integrated database retrieval system