KEGG   Prevotella ruminicola: PRU_1737Help
Entry
PRU_1737          CDS       T01212                                 

Definition
M42 subfamily peptidase (EC:3.4.11.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pru  Prevotella ruminicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PRU_1737
Enzymes [BR:pru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PRU_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2094491..2095537
Genome map
AA seq 348 aa AA seqDB search
MQIDMESWLKDILHKMLLTASPSGSEEQITALFAEQLRPFVDEVTTDVNGNCIAHKQGTG
PKVMIMAHADEIGLMISYIDDRGFLYFKEIGGIDTNLLPGQRVNIMGQQGLVTGVIGKKP
IHLQDKSENTKQLEPEDLWIDIAAKDKSEAQSKVQIGDVATLQGNPVQLNDTLLMSRSLD
DKIGLAVLMGLAQNLQSLQTDKDIYLVASVQEELGARGAKMITEAIRPDIGIAIDVTHAT
DYPTMSPTKDGDISLGKGAVIPMGPNMSKGINQQLISLAKSNGIPYQIEAIARPTGTDAR
EIQVAGTGIRTGLISIPCRYMHTPSEVVSLADADSAITLLSAYLHTRE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattgatatggaatcatggttgaaagacatattgcacaagatgctactgacagca
agtccgtcaggcagcgaagagcaaatcacagcgctctttgctgagcagttacgtcccttt
gtagatgaagtaaccaccgacgtcaatggcaactgcattgcccacaaacagggcactggg
ccaaaagttatgatcatggcgcatgccgatgagattggcttaatgattagttacattgat
gatcgcggtttcctatatttcaaagaaattggcggtatcgacacaaatcttctccccggt
cagcgtgtaaatatcatggggcagcaaggccttgtaacaggcgttataggcaagaagccc
atacatcttcaggacaaatccgagaacaccaagcagctcgaaccagaagacctttggatc
gatattgccgccaaagataaatcagaagcacaatccaaggttcagattggtgatgtagcc
actctccaaggaaatcctgtacaacttaatgacacccttctcatgtcccgatcactagat
gacaaaatcggtttggcagtcttgatgggtctggcacagaatttgcagtccctgcaaaca
gataaggacatctatttagtggcctccgtacaggaagaattaggtgcacgcggtgcaaaa
atgataactgaggctatacgcccagatataggcattgccattgatgtaacccatgccact
gactatcccaccatgtcacccacaaaagatggtgacatcagcctaggcaaaggtgctgtc
atccctatggggcctaacatgagtaaaggtatcaaccagcagctcatcagcttggcaaaa
tccaatggcatcccctatcagatagaggccattgcccgccccacaggcaccgatgcccgc
gagatacaggttgccggcactggcatccgaacaggattgatcagcattccctgccgatat
atgcacaccccttcggaagttgtatcattggcagatgcagatagtgcaataaccctattg
tcggcttatttgcacactcgagaatag

DBGET integrated database retrieval system